BLASTX nr result
ID: Wisteria21_contig00009279
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00009279 (412 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH41924.1| hypothetical protein GLYMA_08G058800 [Glycine max... 114 3e-23 ref|XP_006584929.1| PREDICTED: riboflavin kinase-like [Glycine max] 114 3e-23 ref|XP_004504977.1| PREDICTED: bifunctional riboflavin kinase/FM... 111 2e-22 ref|XP_014506056.1| PREDICTED: bifunctional riboflavin kinase/FM... 111 2e-22 ref|XP_007159253.1| hypothetical protein PHAVU_002G222300g [Phas... 110 5e-22 ref|XP_003529296.1| PREDICTED: pseudouridine-5'-monophosphatase-... 109 7e-22 ref|XP_012091494.1| PREDICTED: bifunctional riboflavin kinase/FM... 107 3e-21 ref|XP_013457113.1| riboflavin kinase/fmn hydrolase [Medicago tr... 105 2e-20 ref|XP_003608231.1| riboflavin kinase/fmn hydrolase [Medicago tr... 105 2e-20 gb|ABD32586.1| Riboflavin kinase / FAD synthetase [Medicago trun... 105 2e-20 gb|AFK49228.1| unknown [Medicago truncatula] 105 2e-20 ref|XP_010277965.1| PREDICTED: bifunctional riboflavin kinase/FM... 103 5e-20 ref|XP_010277964.1| PREDICTED: bifunctional riboflavin kinase/FM... 103 5e-20 ref|XP_010277962.1| PREDICTED: bifunctional riboflavin kinase/FM... 103 5e-20 ref|XP_004146584.1| PREDICTED: bifunctional riboflavin kinase/FM... 103 7e-20 ref|XP_012446833.1| PREDICTED: bifunctional riboflavin kinase/FM... 102 9e-20 gb|KJB57654.1| hypothetical protein B456_009G173700 [Gossypium r... 102 9e-20 ref|XP_012446832.1| PREDICTED: bifunctional riboflavin kinase/FM... 102 9e-20 gb|AFK37688.1| unknown [Lotus japonicus] 102 9e-20 ref|XP_011009006.1| PREDICTED: bifunctional riboflavin kinase/FM... 102 1e-19 >gb|KRH41924.1| hypothetical protein GLYMA_08G058800 [Glycine max] gi|947093340|gb|KRH41925.1| hypothetical protein GLYMA_08G058800 [Glycine max] Length = 193 Score = 114 bits (285), Expect = 3e-23 Identities = 55/59 (93%), Positives = 59/59 (100%) Frame = -1 Query: 412 DFYGEELQLVIVGYIRPEANFPSLESLIAKIHEDRRVAERALDLPLYSSYKNESYLRSS 236 DFYGEEL+LVIVGYIRPEANFPSLESL+AKIHEDRRVAERALDLPLYSS+KN+SYLRSS Sbjct: 135 DFYGEELRLVIVGYIRPEANFPSLESLVAKIHEDRRVAERALDLPLYSSFKNDSYLRSS 193 >ref|XP_006584929.1| PREDICTED: riboflavin kinase-like [Glycine max] Length = 281 Score = 114 bits (285), Expect = 3e-23 Identities = 55/59 (93%), Positives = 59/59 (100%) Frame = -1 Query: 412 DFYGEELQLVIVGYIRPEANFPSLESLIAKIHEDRRVAERALDLPLYSSYKNESYLRSS 236 DFYGEEL+LVIVGYIRPEANFPSLESL+AKIHEDRRVAERALDLPLYSS+KN+SYLRSS Sbjct: 223 DFYGEELRLVIVGYIRPEANFPSLESLVAKIHEDRRVAERALDLPLYSSFKNDSYLRSS 281 >ref|XP_004504977.1| PREDICTED: bifunctional riboflavin kinase/FMN phosphatase [Cicer arietinum] Length = 380 Score = 111 bits (278), Expect = 2e-22 Identities = 54/59 (91%), Positives = 57/59 (96%) Frame = -1 Query: 412 DFYGEELQLVIVGYIRPEANFPSLESLIAKIHEDRRVAERALDLPLYSSYKNESYLRSS 236 DFYGEEL+LVIVGYIRPE NFPSLESLIAKIHEDRRVAERALDLPLYS YKN+SYLR+S Sbjct: 322 DFYGEELRLVIVGYIRPEVNFPSLESLIAKIHEDRRVAERALDLPLYSCYKNDSYLRNS 380 >ref|XP_014506056.1| PREDICTED: bifunctional riboflavin kinase/FMN phosphatase [Vigna radiata var. radiata] Length = 377 Score = 111 bits (277), Expect = 2e-22 Identities = 53/59 (89%), Positives = 58/59 (98%) Frame = -1 Query: 412 DFYGEELQLVIVGYIRPEANFPSLESLIAKIHEDRRVAERALDLPLYSSYKNESYLRSS 236 DFYGEEL+LV+VGYIRPEANFPSLESL+AKIHEDRRVAE ALDLPLYSS+KN+SYLRSS Sbjct: 319 DFYGEELRLVVVGYIRPEANFPSLESLVAKIHEDRRVAEGALDLPLYSSFKNDSYLRSS 377 >ref|XP_007159253.1| hypothetical protein PHAVU_002G222300g [Phaseolus vulgaris] gi|561032668|gb|ESW31247.1| hypothetical protein PHAVU_002G222300g [Phaseolus vulgaris] Length = 377 Score = 110 bits (274), Expect = 5e-22 Identities = 53/59 (89%), Positives = 58/59 (98%) Frame = -1 Query: 412 DFYGEELQLVIVGYIRPEANFPSLESLIAKIHEDRRVAERALDLPLYSSYKNESYLRSS 236 +FYGEEL+LVIVGYIRPEANFPSLESL+AKIHEDRRVAERALDLP YSS+KN+SYLRSS Sbjct: 319 NFYGEELRLVIVGYIRPEANFPSLESLVAKIHEDRRVAERALDLPSYSSFKNDSYLRSS 377 >ref|XP_003529296.1| PREDICTED: pseudouridine-5'-monophosphatase-like [Glycine max] gi|734332295|gb|KHN07318.1| Riboflavin kinase [Glycine soja] gi|947101459|gb|KRH49951.1| hypothetical protein GLYMA_07G190300 [Glycine max] Length = 377 Score = 109 bits (273), Expect = 7e-22 Identities = 53/59 (89%), Positives = 57/59 (96%) Frame = -1 Query: 412 DFYGEELQLVIVGYIRPEANFPSLESLIAKIHEDRRVAERALDLPLYSSYKNESYLRSS 236 DFYGEEL+LVIVGYIRPE NF SLESL+AKIHEDRRVAERALDLPLYSS+KN+SYLRSS Sbjct: 319 DFYGEELRLVIVGYIRPEVNFSSLESLVAKIHEDRRVAERALDLPLYSSFKNDSYLRSS 377 >ref|XP_012091494.1| PREDICTED: bifunctional riboflavin kinase/FMN phosphatase [Jatropha curcas] gi|643703822|gb|KDP20886.1| hypothetical protein JCGZ_21357 [Jatropha curcas] Length = 380 Score = 107 bits (268), Expect = 3e-21 Identities = 51/59 (86%), Positives = 56/59 (94%) Frame = -1 Query: 412 DFYGEELQLVIVGYIRPEANFPSLESLIAKIHEDRRVAERALDLPLYSSYKNESYLRSS 236 DFYGEEL+LVIVGYIRPEANFPSLESLIAKIHEDRR+AERALDLPLYS Y+++ YLR S Sbjct: 320 DFYGEELRLVIVGYIRPEANFPSLESLIAKIHEDRRIAERALDLPLYSKYRDDPYLRGS 378 >ref|XP_013457113.1| riboflavin kinase/fmn hydrolase [Medicago truncatula] gi|657389436|gb|KEH31144.1| riboflavin kinase/fmn hydrolase [Medicago truncatula] Length = 318 Score = 105 bits (261), Expect = 2e-20 Identities = 50/59 (84%), Positives = 57/59 (96%) Frame = -1 Query: 412 DFYGEELQLVIVGYIRPEANFPSLESLIAKIHEDRRVAERALDLPLYSSYKNESYLRSS 236 DFYGEEL+LVIVGYIRPE NFP+LESLIAKIHEDRRVAE AL+LP+YSS+K++SYLRSS Sbjct: 260 DFYGEELKLVIVGYIRPEVNFPTLESLIAKIHEDRRVAESALELPMYSSHKDDSYLRSS 318 >ref|XP_003608231.1| riboflavin kinase/fmn hydrolase [Medicago truncatula] gi|217072412|gb|ACJ84566.1| unknown [Medicago truncatula] gi|355509286|gb|AES90428.1| riboflavin kinase/fmn hydrolase [Medicago truncatula] gi|388509552|gb|AFK42842.1| unknown [Medicago truncatula] Length = 377 Score = 105 bits (261), Expect = 2e-20 Identities = 50/59 (84%), Positives = 57/59 (96%) Frame = -1 Query: 412 DFYGEELQLVIVGYIRPEANFPSLESLIAKIHEDRRVAERALDLPLYSSYKNESYLRSS 236 DFYGEEL+LVIVGYIRPE NFP+LESLIAKIHEDRRVAE AL+LP+YSS+K++SYLRSS Sbjct: 319 DFYGEELKLVIVGYIRPEVNFPTLESLIAKIHEDRRVAESALELPMYSSHKDDSYLRSS 377 >gb|ABD32586.1| Riboflavin kinase / FAD synthetase [Medicago truncatula] Length = 237 Score = 105 bits (261), Expect = 2e-20 Identities = 50/59 (84%), Positives = 57/59 (96%) Frame = -1 Query: 412 DFYGEELQLVIVGYIRPEANFPSLESLIAKIHEDRRVAERALDLPLYSSYKNESYLRSS 236 DFYGEEL+LVIVGYIRPE NFP+LESLIAKIHEDRRVAE AL+LP+YSS+K++SYLRSS Sbjct: 179 DFYGEELKLVIVGYIRPEVNFPTLESLIAKIHEDRRVAESALELPMYSSHKDDSYLRSS 237 >gb|AFK49228.1| unknown [Medicago truncatula] Length = 377 Score = 105 bits (261), Expect = 2e-20 Identities = 50/59 (84%), Positives = 57/59 (96%) Frame = -1 Query: 412 DFYGEELQLVIVGYIRPEANFPSLESLIAKIHEDRRVAERALDLPLYSSYKNESYLRSS 236 DFYGEEL+LVIVGYIRPE NFP+LESLIAKIHEDRRVAE AL+LP+YSS+K++SYLRSS Sbjct: 319 DFYGEELKLVIVGYIRPEVNFPTLESLIAKIHEDRRVAESALELPMYSSHKDDSYLRSS 377 >ref|XP_010277965.1| PREDICTED: bifunctional riboflavin kinase/FMN phosphatase-like isoform X3 [Nelumbo nucifera] Length = 361 Score = 103 bits (257), Expect = 5e-20 Identities = 48/59 (81%), Positives = 54/59 (91%) Frame = -1 Query: 412 DFYGEELQLVIVGYIRPEANFPSLESLIAKIHEDRRVAERALDLPLYSSYKNESYLRSS 236 DFYGEEL LVIVGYIRPEANFPSLESLI KIHEDR++AE+ALDLPLY Y+N+ YLR+S Sbjct: 303 DFYGEELHLVIVGYIRPEANFPSLESLIEKIHEDRKIAEKALDLPLYVGYRNDQYLRTS 361 >ref|XP_010277964.1| PREDICTED: bifunctional riboflavin kinase/FMN phosphatase-like isoform X2 [Nelumbo nucifera] Length = 380 Score = 103 bits (257), Expect = 5e-20 Identities = 48/59 (81%), Positives = 54/59 (91%) Frame = -1 Query: 412 DFYGEELQLVIVGYIRPEANFPSLESLIAKIHEDRRVAERALDLPLYSSYKNESYLRSS 236 DFYGEEL LVIVGYIRPEANFPSLESLI KIHEDR++AE+ALDLPLY Y+N+ YLR+S Sbjct: 322 DFYGEELHLVIVGYIRPEANFPSLESLIEKIHEDRKIAEKALDLPLYVGYRNDQYLRTS 380 >ref|XP_010277962.1| PREDICTED: bifunctional riboflavin kinase/FMN phosphatase-like isoform X1 [Nelumbo nucifera] gi|720071114|ref|XP_010277963.1| PREDICTED: bifunctional riboflavin kinase/FMN phosphatase-like isoform X1 [Nelumbo nucifera] Length = 384 Score = 103 bits (257), Expect = 5e-20 Identities = 48/59 (81%), Positives = 54/59 (91%) Frame = -1 Query: 412 DFYGEELQLVIVGYIRPEANFPSLESLIAKIHEDRRVAERALDLPLYSSYKNESYLRSS 236 DFYGEEL LVIVGYIRPEANFPSLESLI KIHEDR++AE+ALDLPLY Y+N+ YLR+S Sbjct: 326 DFYGEELHLVIVGYIRPEANFPSLESLIEKIHEDRKIAEKALDLPLYVGYRNDQYLRTS 384 >ref|XP_004146584.1| PREDICTED: bifunctional riboflavin kinase/FMN phosphatase [Cucumis sativus] gi|778658630|ref|XP_011653006.1| PREDICTED: bifunctional riboflavin kinase/FMN phosphatase [Cucumis sativus] gi|700209534|gb|KGN64630.1| hypothetical protein Csa_1G071920 [Cucumis sativus] Length = 386 Score = 103 bits (256), Expect = 7e-20 Identities = 47/57 (82%), Positives = 54/57 (94%) Frame = -1 Query: 412 DFYGEELQLVIVGYIRPEANFPSLESLIAKIHEDRRVAERALDLPLYSSYKNESYLR 242 DFYGE+L+LV+VGYIRPEANFPSLESLIAKIHED R+AERALDLPLYS Y+N+ YL+ Sbjct: 326 DFYGEDLRLVVVGYIRPEANFPSLESLIAKIHEDGRIAERALDLPLYSKYRNDQYLK 382 >ref|XP_012446833.1| PREDICTED: bifunctional riboflavin kinase/FMN phosphatase isoform X2 [Gossypium raimondii] gi|763790659|gb|KJB57655.1| hypothetical protein B456_009G173700 [Gossypium raimondii] Length = 380 Score = 102 bits (255), Expect = 9e-20 Identities = 48/59 (81%), Positives = 55/59 (93%) Frame = -1 Query: 412 DFYGEELQLVIVGYIRPEANFPSLESLIAKIHEDRRVAERALDLPLYSSYKNESYLRSS 236 DFYGEEL+LVIVGY+RPE NFPSLESLIAKIHED+R+AERALDLPLYS +K++ YL SS Sbjct: 314 DFYGEELRLVIVGYLRPEVNFPSLESLIAKIHEDKRIAERALDLPLYSKHKDDPYLSSS 372 >gb|KJB57654.1| hypothetical protein B456_009G173700 [Gossypium raimondii] Length = 373 Score = 102 bits (255), Expect = 9e-20 Identities = 48/59 (81%), Positives = 55/59 (93%) Frame = -1 Query: 412 DFYGEELQLVIVGYIRPEANFPSLESLIAKIHEDRRVAERALDLPLYSSYKNESYLRSS 236 DFYGEEL+LVIVGY+RPE NFPSLESLIAKIHED+R+AERALDLPLYS +K++ YL SS Sbjct: 307 DFYGEELRLVIVGYLRPEVNFPSLESLIAKIHEDKRIAERALDLPLYSKHKDDPYLSSS 365 >ref|XP_012446832.1| PREDICTED: bifunctional riboflavin kinase/FMN phosphatase isoform X1 [Gossypium raimondii] gi|763790655|gb|KJB57651.1| hypothetical protein B456_009G173700 [Gossypium raimondii] Length = 386 Score = 102 bits (255), Expect = 9e-20 Identities = 48/59 (81%), Positives = 55/59 (93%) Frame = -1 Query: 412 DFYGEELQLVIVGYIRPEANFPSLESLIAKIHEDRRVAERALDLPLYSSYKNESYLRSS 236 DFYGEEL+LVIVGY+RPE NFPSLESLIAKIHED+R+AERALDLPLYS +K++ YL SS Sbjct: 320 DFYGEELRLVIVGYLRPEVNFPSLESLIAKIHEDKRIAERALDLPLYSKHKDDPYLSSS 378 >gb|AFK37688.1| unknown [Lotus japonicus] Length = 82 Score = 102 bits (255), Expect = 9e-20 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = -1 Query: 412 DFYGEELQLVIVGYIRPEANFPSLESLIAKIHEDRRVAERALDLPLYSSYKNES 251 DFYGEEL+LVIVGYIR EANFP+LESLIAKIHEDRRVAERALDLPLYSSYKN+S Sbjct: 29 DFYGEELRLVIVGYIRAEANFPTLESLIAKIHEDRRVAERALDLPLYSSYKNDS 82 >ref|XP_011009006.1| PREDICTED: bifunctional riboflavin kinase/FMN phosphatase-like [Populus euphratica] Length = 233 Score = 102 bits (254), Expect = 1e-19 Identities = 49/59 (83%), Positives = 54/59 (91%) Frame = -1 Query: 412 DFYGEELQLVIVGYIRPEANFPSLESLIAKIHEDRRVAERALDLPLYSSYKNESYLRSS 236 DFYGEEL+LVIVGYIRPEANF SLESLIAKIHEDRR+AERALDLPLY YK++ YL+ S Sbjct: 173 DFYGEELRLVIVGYIRPEANFTSLESLIAKIHEDRRIAERALDLPLYLKYKDDPYLKGS 231