BLASTX nr result
ID: Wisteria21_contig00009145
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00009145 (580 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007141001.1| hypothetical protein PHAVU_008G158900g [Phas... 78 4e-12 gb|AGV54687.1| pectinesterase [Phaseolus vulgaris] 78 4e-12 ref|XP_004498516.1| PREDICTED: probable pectinesterase/pectinest... 77 6e-12 gb|KRH16506.1| hypothetical protein GLYMA_14G159600 [Glycine max] 76 1e-11 gb|KHN44643.1| Putative pectinesterase/pectinesterase inhibitor ... 76 1e-11 ref|XP_014505001.1| PREDICTED: probable pectinesterase/pectinest... 75 2e-11 ref|XP_003588521.1| pectinesterase/pectinesterase inhibitor [Med... 74 4e-11 gb|ACF74360.1| pectinesterase [Arachis hypogaea] 73 9e-11 ref|XP_002516698.1| Pectinesterase PPE8B precursor, putative [Ri... 71 4e-10 ref|XP_014518708.1| PREDICTED: probable pectinesterase/pectinest... 70 8e-10 gb|KOM48166.1| hypothetical protein LR48_Vigan07g187000 [Vigna a... 70 8e-10 ref|XP_007039038.1| Plant invertase/pectin methylesterase inhibi... 70 8e-10 ref|XP_012084535.1| PREDICTED: probable pectinesterase/pectinest... 70 1e-09 ref|XP_012488591.1| PREDICTED: probable pectinesterase/pectinest... 69 1e-09 ref|XP_008465502.1| PREDICTED: probable pectinesterase/pectinest... 69 1e-09 ref|XP_002321999.2| pectin methylesterase family protein [Populu... 69 1e-09 ref|XP_006374102.1| hypothetical protein POPTR_0015s01610g [Popu... 69 1e-09 ref|XP_004146219.1| PREDICTED: probable pectinesterase/pectinest... 69 1e-09 ref|XP_011006351.1| PREDICTED: probable pectinesterase/pectinest... 69 2e-09 ref|XP_008380988.1| PREDICTED: probable pectinesterase/pectinest... 69 2e-09 >ref|XP_007141001.1| hypothetical protein PHAVU_008G158900g [Phaseolus vulgaris] gi|561014134|gb|ESW12995.1| hypothetical protein PHAVU_008G158900g [Phaseolus vulgaris] Length = 609 Score = 77.8 bits (190), Expect = 4e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -3 Query: 116 KPTQAISRTCSKTRFPTLCINSLLDFPGSTAASEQDLV 3 KPTQAISRTCSKTRFPTLC+NSLLDFPGST ASEQDLV Sbjct: 78 KPTQAISRTCSKTRFPTLCVNSLLDFPGSTTASEQDLV 115 >gb|AGV54687.1| pectinesterase [Phaseolus vulgaris] Length = 606 Score = 77.8 bits (190), Expect = 4e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -3 Query: 116 KPTQAISRTCSKTRFPTLCINSLLDFPGSTAASEQDLV 3 KPTQAISRTCSKTRFPTLC+NSLLDFPGST ASEQDLV Sbjct: 78 KPTQAISRTCSKTRFPTLCVNSLLDFPGSTTASEQDLV 115 >ref|XP_004498516.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 [Cicer arietinum] Length = 606 Score = 77.0 bits (188), Expect = 6e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 116 KPTQAISRTCSKTRFPTLCINSLLDFPGSTAASEQDLV 3 KPTQAISRTCSKTRFPTLCINSLLDFPGST+ASEQ+LV Sbjct: 78 KPTQAISRTCSKTRFPTLCINSLLDFPGSTSASEQELV 115 >gb|KRH16506.1| hypothetical protein GLYMA_14G159600 [Glycine max] Length = 614 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 113 PTQAISRTCSKTRFPTLCINSLLDFPGSTAASEQDLV 3 PTQAISRTCSKTRFPTLCINSLLDFPGST ASEQDL+ Sbjct: 79 PTQAISRTCSKTRFPTLCINSLLDFPGSTTASEQDLI 115 >gb|KHN44643.1| Putative pectinesterase/pectinesterase inhibitor 61 [Glycine soja] Length = 610 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 113 PTQAISRTCSKTRFPTLCINSLLDFPGSTAASEQDLV 3 PTQAISRTCSKTRFPTLCINSLLDFPGST ASEQDL+ Sbjct: 79 PTQAISRTCSKTRFPTLCINSLLDFPGSTTASEQDLI 115 >ref|XP_014505001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 61 [Vigna radiata var. radiata] Length = 612 Score = 75.5 bits (184), Expect = 2e-11 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -3 Query: 116 KPTQAISRTCSKTRFPTLCINSLLDFPGSTAASEQDLV 3 KPTQAISRTCSKTRFP LCINSL+DFPGST ASEQDLV Sbjct: 78 KPTQAISRTCSKTRFPALCINSLIDFPGSTTASEQDLV 115 >ref|XP_003588521.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula] gi|355477569|gb|AES58772.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula] Length = 609 Score = 74.3 bits (181), Expect = 4e-11 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = -3 Query: 116 KPTQAISRTCSKTRFPTLCINSLLDFPGSTAASEQDLV 3 KPTQAISRTCSKTR+P+LCINSLLDFPGST+ASEQ+LV Sbjct: 77 KPTQAISRTCSKTRYPSLCINSLLDFPGSTSASEQELV 114 >gb|ACF74360.1| pectinesterase [Arachis hypogaea] Length = 177 Score = 73.2 bits (178), Expect = 9e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -3 Query: 116 KPTQAISRTCSKTRFPTLCINSLLDFPGSTAASEQDLV 3 KPTQAISRTCS+TRFP LC+NSLLDFPGSTAA+E+DLV Sbjct: 75 KPTQAISRTCSRTRFPDLCVNSLLDFPGSTAATERDLV 112 >ref|XP_002516698.1| Pectinesterase PPE8B precursor, putative [Ricinus communis] gi|223544193|gb|EEF45717.1| Pectinesterase PPE8B precursor, putative [Ricinus communis] Length = 562 Score = 70.9 bits (172), Expect = 4e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 116 KPTQAISRTCSKTRFPTLCINSLLDFPGSTAASEQDLV 3 KPTQAIS+TC KTRFP LC+NSLLDFPGS ASEQDLV Sbjct: 81 KPTQAISKTCGKTRFPALCVNSLLDFPGSLTASEQDLV 118 >ref|XP_014518708.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 [Vigna radiata var. radiata] Length = 575 Score = 70.1 bits (170), Expect = 8e-10 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -3 Query: 116 KPTQAISRTCSKTRFPTLCINSLLDFPGSTAASEQDLV 3 KPTQAISRTCSKTRF T+C+NSLLDFPGS AASE+DL+ Sbjct: 59 KPTQAISRTCSKTRFQTVCVNSLLDFPGSQAASEKDLL 96 >gb|KOM48166.1| hypothetical protein LR48_Vigan07g187000 [Vigna angularis] Length = 615 Score = 70.1 bits (170), Expect = 8e-10 Identities = 35/41 (85%), Positives = 36/41 (87%), Gaps = 3/41 (7%) Frame = -3 Query: 116 KPTQA---ISRTCSKTRFPTLCINSLLDFPGSTAASEQDLV 3 KPTQA ISRTCSKTRFP LCINSL+DFPGST ASEQDLV Sbjct: 78 KPTQARPAISRTCSKTRFPALCINSLIDFPGSTTASEQDLV 118 >ref|XP_007039038.1| Plant invertase/pectin methylesterase inhibitor superfamily isoform 1 [Theobroma cacao] gi|590673982|ref|XP_007039039.1| Plant invertase/pectin methylesterase inhibitor superfamily isoform 1 [Theobroma cacao] gi|508776283|gb|EOY23539.1| Plant invertase/pectin methylesterase inhibitor superfamily isoform 1 [Theobroma cacao] gi|508776284|gb|EOY23540.1| Plant invertase/pectin methylesterase inhibitor superfamily isoform 1 [Theobroma cacao] Length = 606 Score = 70.1 bits (170), Expect = 8e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 116 KPTQAISRTCSKTRFPTLCINSLLDFPGSTAASEQDLV 3 KPTQA+SRTCSKTRFP LC+NSLLDFPGS A+E+DLV Sbjct: 75 KPTQAMSRTCSKTRFPNLCVNSLLDFPGSLTANEEDLV 112 >ref|XP_012084535.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 [Jatropha curcas] gi|643715368|gb|KDP27467.1| hypothetical protein JCGZ_20123 [Jatropha curcas] Length = 605 Score = 69.7 bits (169), Expect = 1e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 116 KPTQAISRTCSKTRFPTLCINSLLDFPGSTAASEQDLV 3 KPT+AIS+ C KTRFPTLC+NSLLDFPGST ASE+DLV Sbjct: 77 KPTKAISKACRKTRFPTLCVNSLLDFPGSTTASEKDLV 114 >ref|XP_012488591.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 [Gossypium raimondii] gi|763772349|gb|KJB39472.1| hypothetical protein B456_007G015300 [Gossypium raimondii] Length = 606 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -3 Query: 116 KPTQAISRTCSKTRFPTLCINSLLDFPGSTAASEQDLV 3 KPT+AIS+TCSK RFP+LC+NSLL+FPGS AASEQDLV Sbjct: 82 KPTRAISKTCSKARFPSLCVNSLLEFPGSLAASEQDLV 119 >ref|XP_008465502.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 [Cucumis melo] Length = 405 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 116 KPTQAISRTCSKTRFPTLCINSLLDFPGSTAASEQDLV 3 KPTQAIS+ CS+TRFPTLC+NSLLDFPGS A+EQDLV Sbjct: 79 KPTQAISKACSRTRFPTLCVNSLLDFPGSLNANEQDLV 116 >ref|XP_002321999.2| pectin methylesterase family protein [Populus trichocarpa] gi|550321746|gb|EEF06126.2| pectin methylesterase family protein [Populus trichocarpa] Length = 605 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 116 KPTQAISRTCSKTRFPTLCINSLLDFPGSTAASEQDLV 3 KPTQAIS+TCSKTRFP LC++SLLDFPGS +ASE DLV Sbjct: 82 KPTQAISKTCSKTRFPNLCVSSLLDFPGSVSASESDLV 119 >ref|XP_006374102.1| hypothetical protein POPTR_0015s01610g [Populus trichocarpa] gi|550321745|gb|ERP51899.1| hypothetical protein POPTR_0015s01610g [Populus trichocarpa] Length = 594 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 116 KPTQAISRTCSKTRFPTLCINSLLDFPGSTAASEQDLV 3 KPTQAIS+TCSKTRFP LC++SLLDFPGS +ASE DLV Sbjct: 82 KPTQAISKTCSKTRFPNLCVSSLLDFPGSVSASESDLV 119 >ref|XP_004146219.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 [Cucumis sativus] gi|700202542|gb|KGN57675.1| hypothetical protein Csa_3G239880 [Cucumis sativus] Length = 605 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 116 KPTQAISRTCSKTRFPTLCINSLLDFPGSTAASEQDLV 3 KPTQAIS+ CS+TRFPTLC+NSLLDFPGS A+EQDLV Sbjct: 79 KPTQAISKACSRTRFPTLCVNSLLDFPGSLNANEQDLV 116 >ref|XP_011006351.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 [Populus euphratica] Length = 605 Score = 68.9 bits (167), Expect = 2e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 116 KPTQAISRTCSKTRFPTLCINSLLDFPGSTAASEQDLV 3 KPTQAIS+TCSKTRFP LC+ SLLDFPGS +ASE DLV Sbjct: 82 KPTQAISKTCSKTRFPNLCVRSLLDFPGSVSASESDLV 119 >ref|XP_008380988.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 34 [Malus domestica] Length = 613 Score = 68.9 bits (167), Expect = 2e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 116 KPTQAISRTCSKTRFPTLCINSLLDFPGSTAASEQDLV 3 KPTQAIS C+KTRFP+LC++SLLDFPGS AASEQDLV Sbjct: 84 KPTQAISNACAKTRFPSLCVDSLLDFPGSNAASEQDLV 121