BLASTX nr result
ID: Wisteria21_contig00009100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00009100 (205 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004509033.1| PREDICTED: poly(U)-specific endoribonuclease... 71 3e-10 gb|ACJ83323.1| unknown [Medicago truncatula] 56 9e-06 >ref|XP_004509033.1| PREDICTED: poly(U)-specific endoribonuclease-B [Cicer arietinum] Length = 431 Score = 71.2 bits (173), Expect = 3e-10 Identities = 37/69 (53%), Positives = 49/69 (71%), Gaps = 3/69 (4%) Frame = -3 Query: 200 QEQEECQPHQGSRINSNRPHKYKEEVEPWQDDSYRHRPDHKEQFRPQQQEWESQ---SSN 30 +EQ+E +GSR ++N KEEVEPWQD+S HR KEQ+RPQQQ++ES+ +SN Sbjct: 50 KEQKEEWQSEGSRFSNN-----KEEVEPWQDESSNHRRPRKEQYRPQQQDYESETFNTSN 104 Query: 29 RPYKLDEDD 3 RP K DED+ Sbjct: 105 RPNKSDEDN 113 >gb|ACJ83323.1| unknown [Medicago truncatula] Length = 217 Score = 56.2 bits (134), Expect = 9e-06 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 6/60 (10%) Frame = -3 Query: 170 GSRINSNRPHKYKEEVEPWQDDSYRHRP-DHKEQFRP--QQQEWESQ---SSNRPYKLDE 9 G + + H KEEVE WQD+S RH P HKEQ+RP Q+QE+ES+ S NRP K DE Sbjct: 40 GDQEKDSDHHPQKEEVETWQDNSNRHSPRPHKEQYRPQTQRQEYESETFNSPNRPNKSDE 99