BLASTX nr result
ID: Wisteria21_contig00009034
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00009034 (753 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012571564.1| PREDICTED: VQ motif-containing protein 9-lik... 65 4e-08 ref|XP_012571551.1| PREDICTED: VQ motif-containing protein 9 [Ci... 65 4e-08 ref|XP_003602826.1| VQ motif protein [Medicago truncatula] gi|35... 60 2e-06 >ref|XP_012571564.1| PREDICTED: VQ motif-containing protein 9-like [Cicer arietinum] Length = 352 Score = 65.5 bits (158), Expect = 4e-08 Identities = 33/48 (68%), Positives = 35/48 (72%) Frame = -3 Query: 652 GFGRXXXXXXXXXXXPTVHAPADSPISAYMRDLQNFVSTMDSKSFSGF 509 GFGR PTVHAPA+SPISAYMRDLQN VSTMDSK F+GF Sbjct: 186 GFGRPLAPLSPLPPFPTVHAPAESPISAYMRDLQNLVSTMDSKGFTGF 233 >ref|XP_012571551.1| PREDICTED: VQ motif-containing protein 9 [Cicer arietinum] Length = 352 Score = 65.5 bits (158), Expect = 4e-08 Identities = 33/48 (68%), Positives = 35/48 (72%) Frame = -3 Query: 652 GFGRXXXXXXXXXXXPTVHAPADSPISAYMRDLQNFVSTMDSKSFSGF 509 GFGR PTVHAPA+SPISAYMRDLQN VSTMDSK F+GF Sbjct: 186 GFGRPLAPLSPLPPFPTVHAPAESPISAYMRDLQNLVSTMDSKGFTGF 233 >ref|XP_003602826.1| VQ motif protein [Medicago truncatula] gi|355491874|gb|AES73077.1| VQ motif protein [Medicago truncatula] Length = 310 Score = 60.1 bits (144), Expect = 2e-06 Identities = 31/48 (64%), Positives = 33/48 (68%) Frame = -3 Query: 652 GFGRXXXXXXXXXXXPTVHAPADSPISAYMRDLQNFVSTMDSKSFSGF 509 G GR PTVHA A+SPISAYMRDLQNF ST+DSK FSGF Sbjct: 161 GLGRPQAPLSPLPPFPTVHAAAESPISAYMRDLQNFCSTIDSKGFSGF 208