BLASTX nr result
ID: Wisteria21_contig00006720
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00006720 (638 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACJ85386.1| unknown [Medicago truncatula] gi|388506672|gb|AFK... 49 3e-06 ref|XP_004485689.1| PREDICTED: nitric oxide synthase-interacting... 49 3e-06 gb|AFK46079.1| unknown [Medicago truncatula] 49 3e-06 ref|XP_013462451.1| nitric oxide synthase interacting protein [M... 49 3e-06 ref|XP_014519146.1| PREDICTED: nitric oxide synthase-interacting... 49 4e-06 gb|KOM53863.1| hypothetical protein LR48_Vigan09g252200 [Vigna a... 49 4e-06 ref|XP_007148264.1| hypothetical protein PHAVU_006G193700g [Phas... 49 4e-06 ref|XP_003543096.1| PREDICTED: nitric oxide synthase-interacting... 49 4e-06 gb|ACU20978.1| unknown [Glycine max] 49 1e-05 >gb|ACJ85386.1| unknown [Medicago truncatula] gi|388506672|gb|AFK41402.1| unknown [Medicago truncatula] Length = 304 Score = 49.3 bits (116), Expect(2) = 3e-06 Identities = 27/60 (45%), Positives = 33/60 (55%), Gaps = 5/60 (8%) Frame = -3 Query: 534 LVAFASEQTLVHKGLVHHDGVAPCQSYYESKKF-----KENDAFDQQNHGVVPQYSDRNY 370 L S++ + + LV H + E +K KE DAFDQQNHG VPQYSDRNY Sbjct: 68 LECLLSQKKDIQRRLVAHSAQQKQEKEEEEEKLMLQRAKELDAFDQQNHGAVPQYSDRNY 127 Score = 29.3 bits (64), Expect(2) = 3e-06 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 362 NKKGFHGANSVKVT 321 +K GFHGANSVKVT Sbjct: 130 DKNGFHGANSVKVT 143 >ref|XP_004485689.1| PREDICTED: nitric oxide synthase-interacting protein [Cicer arietinum] Length = 304 Score = 49.3 bits (116), Expect(2) = 3e-06 Identities = 27/60 (45%), Positives = 33/60 (55%), Gaps = 5/60 (8%) Frame = -3 Query: 534 LVAFASEQTLVHKGLVHHDGVAPCQSYYESKKF-----KENDAFDQQNHGVVPQYSDRNY 370 L S++ + + LV H + E +K KE DAFDQQNHG VPQYSDRNY Sbjct: 68 LQCLLSQKKDIQRRLVAHSAQQKQEKEEEEEKLMLQKAKELDAFDQQNHGAVPQYSDRNY 127 Score = 29.3 bits (64), Expect(2) = 3e-06 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 362 NKKGFHGANSVKVT 321 +K GFHGANSVKVT Sbjct: 130 DKNGFHGANSVKVT 143 >gb|AFK46079.1| unknown [Medicago truncatula] Length = 304 Score = 49.3 bits (116), Expect(2) = 3e-06 Identities = 27/60 (45%), Positives = 33/60 (55%), Gaps = 5/60 (8%) Frame = -3 Query: 534 LVAFASEQTLVHKGLVHHDGVAPCQSYYESKKF-----KENDAFDQQNHGVVPQYSDRNY 370 L S++ + + LV H + E +K KE DAFDQQNHG VPQYSDRNY Sbjct: 68 LECLLSQKKDIQRRLVAHSAQQKQEKEEEEEKLMLQKAKELDAFDQQNHGAVPQYSDRNY 127 Score = 29.3 bits (64), Expect(2) = 3e-06 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 362 NKKGFHGANSVKVT 321 +K GFHGANSVKVT Sbjct: 130 DKNGFHGANSVKVT 143 >ref|XP_013462451.1| nitric oxide synthase interacting protein [Medicago truncatula] gi|388497328|gb|AFK36730.1| unknown [Medicago truncatula] gi|657396526|gb|KEH36486.1| nitric oxide synthase interacting protein [Medicago truncatula] Length = 304 Score = 49.3 bits (116), Expect(2) = 3e-06 Identities = 27/60 (45%), Positives = 33/60 (55%), Gaps = 5/60 (8%) Frame = -3 Query: 534 LVAFASEQTLVHKGLVHHDGVAPCQSYYESKKF-----KENDAFDQQNHGVVPQYSDRNY 370 L S++ + + LV H + E +K KE DAFDQQNHG VPQYSDRNY Sbjct: 68 LECLLSQKKDIQRRLVAHSAQQKQEKEEEEEKLMLQKAKELDAFDQQNHGAVPQYSDRNY 127 Score = 29.3 bits (64), Expect(2) = 3e-06 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 362 NKKGFHGANSVKVT 321 +K GFHGANSVKVT Sbjct: 130 DKNGFHGANSVKVT 143 >ref|XP_014519146.1| PREDICTED: nitric oxide synthase-interacting protein [Vigna radiata var. radiata] Length = 304 Score = 48.5 bits (114), Expect(2) = 4e-06 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -3 Query: 444 KKFKENDAFDQQNHGVVPQYSDRNY 370 +K KE DAFDQQNHG VPQYSDRNY Sbjct: 103 QKAKELDAFDQQNHGAVPQYSDRNY 127 Score = 29.3 bits (64), Expect(2) = 4e-06 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 362 NKKGFHGANSVKVT 321 +K GFHGANSVKVT Sbjct: 130 DKNGFHGANSVKVT 143 >gb|KOM53863.1| hypothetical protein LR48_Vigan09g252200 [Vigna angularis] Length = 304 Score = 48.5 bits (114), Expect(2) = 4e-06 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -3 Query: 444 KKFKENDAFDQQNHGVVPQYSDRNY 370 +K KE DAFDQQNHG VPQYSDRNY Sbjct: 103 QKAKELDAFDQQNHGAVPQYSDRNY 127 Score = 29.3 bits (64), Expect(2) = 4e-06 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 362 NKKGFHGANSVKVT 321 +K GFHGANSVKVT Sbjct: 130 DKNGFHGANSVKVT 143 >ref|XP_007148264.1| hypothetical protein PHAVU_006G193700g [Phaseolus vulgaris] gi|561021487|gb|ESW20258.1| hypothetical protein PHAVU_006G193700g [Phaseolus vulgaris] Length = 304 Score = 48.5 bits (114), Expect(2) = 4e-06 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -3 Query: 444 KKFKENDAFDQQNHGVVPQYSDRNY 370 +K KE DAFDQQNHG VPQYSDRNY Sbjct: 103 QKAKELDAFDQQNHGAVPQYSDRNY 127 Score = 29.3 bits (64), Expect(2) = 4e-06 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 362 NKKGFHGANSVKVT 321 +K GFHGANSVKVT Sbjct: 130 DKNGFHGANSVKVT 143 >ref|XP_003543096.1| PREDICTED: nitric oxide synthase-interacting protein-like [Glycine max] gi|734369129|gb|KHN19093.1| Nitric oxide synthase-interacting protein [Glycine soja] gi|947072705|gb|KRH21596.1| hypothetical protein GLYMA_13G247800 [Glycine max] Length = 304 Score = 48.5 bits (114), Expect(2) = 4e-06 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -3 Query: 444 KKFKENDAFDQQNHGVVPQYSDRNY 370 +K KE DAFDQQNHG VPQYSDRNY Sbjct: 103 QKAKELDAFDQQNHGAVPQYSDRNY 127 Score = 29.3 bits (64), Expect(2) = 4e-06 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 362 NKKGFHGANSVKVT 321 +K GFHGANSVKVT Sbjct: 130 DKNGFHGANSVKVT 143 >gb|ACU20978.1| unknown [Glycine max] Length = 304 Score = 48.5 bits (114), Expect(2) = 1e-05 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -3 Query: 444 KKFKENDAFDQQNHGVVPQYSDRNY 370 +K KE DAFDQQNHG VPQYSDRNY Sbjct: 103 QKAKELDAFDQQNHGAVPQYSDRNY 127 Score = 28.1 bits (61), Expect(2) = 1e-05 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -1 Query: 362 NKKGFHGANSVKVT 321 +K GFHGANS+KVT Sbjct: 130 DKNGFHGANSLKVT 143