BLASTX nr result
ID: Wisteria21_contig00006719
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00006719 (249 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010106723.1| Nitric oxide synthase-interacting protein [M... 57 7e-06 >ref|XP_010106723.1| Nitric oxide synthase-interacting protein [Morus notabilis] gi|587924286|gb|EXC11591.1| Nitric oxide synthase-interacting protein [Morus notabilis] Length = 330 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -2 Query: 248 FDQQNHGAVPQYSDRKLEIIGCNKKGFHGANSVKVT 141 FDQQNHGAVPQYSDR L +K GFHGANSVKVT Sbjct: 111 FDQQNHGAVPQYSDRNL---SRDKNGFHGANSVKVT 143