BLASTX nr result
ID: Wisteria21_contig00006654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00006654 (386 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK33482.1| unknown [Medicago truncatula] 59 1e-06 >gb|AFK33482.1| unknown [Medicago truncatula] Length = 80 Score = 59.3 bits (142), Expect = 1e-06 Identities = 35/73 (47%), Positives = 40/73 (54%) Frame = +3 Query: 168 HINKIKLDHFAIWLGSRELHLKHRGTPREQIFFWNFCTICSEDHPSLTLQEVSPSDVWRH 347 H+ K H AIWLGSR + + + + F T SLTLQEVSPSDVWRH Sbjct: 10 HLKKKNTKHGAIWLGSRNIETLSKFSLGTFVLFAPRIT-------SLTLQEVSPSDVWRH 62 Query: 348 NDH*VVFDLQVEP 386 ND V DLQV P Sbjct: 63 NDQQVGLDLQVGP 75