BLASTX nr result
ID: Wisteria21_contig00004484
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00004484 (306 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM28455.1| hypothetical protein LR48_Vigan549s001000 [Vigna ... 81 3e-13 gb|AFK40346.1| unknown [Lotus japonicus] 80 5e-13 gb|KHN24977.1| NAC domain-containing protein 29 [Glycine soja] g... 80 8e-13 ref|XP_014498272.1| PREDICTED: NAC domain-containing protein 83-... 79 1e-12 ref|XP_014496413.1| PREDICTED: NAC domain-containing protein 83-... 79 1e-12 gb|KOM28456.1| hypothetical protein LR48_Vigan549s001100 [Vigna ... 79 1e-12 ref|XP_007139098.1| hypothetical protein PHAVU_008G001000g [Phas... 79 1e-12 ref|XP_007139097.1| hypothetical protein PHAVU_008G001000g [Phas... 79 1e-12 gb|ACU14039.1| unknown [Glycine max] 79 2e-12 ref|NP_001238630.1| NAC domain protein [Glycine max] gi|18794028... 79 2e-12 gb|ACU15279.1| unknown [Glycine max] 78 3e-12 ref|NP_001238078.1| NAC domain protein [Glycine max] gi|18794028... 78 3e-12 ref|XP_010533371.1| PREDICTED: NAC domain-containing protein 18-... 76 9e-12 gb|ALC79012.1| NAC transcription factors 35 [Manihot esculenta] 76 1e-11 gb|ALC79011.1| NAC transcription factors 34 [Manihot esculenta] 76 1e-11 ref|XP_002512632.1| NAC domain-containing protein, putative [Ric... 76 1e-11 ref|XP_012088760.1| PREDICTED: NAC transcription factor 25 [Jatr... 76 1e-11 ref|XP_004140548.1| PREDICTED: NAC domain-containing protein 18 ... 76 1e-11 ref|XP_010090688.1| NAC domain-containing protein 29 [Morus nota... 75 1e-11 ref|XP_011020822.1| PREDICTED: NAC transcription factor ONAC010-... 75 2e-11 >gb|KOM28455.1| hypothetical protein LR48_Vigan549s001000 [Vigna angularis] Length = 266 Score = 81.3 bits (199), Expect = 3e-13 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -3 Query: 130 RMEKVVNFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSSPL 2 RMEK+ NFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFS PL Sbjct: 104 RMEKL-NFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSFPL 145 >gb|AFK40346.1| unknown [Lotus japonicus] Length = 235 Score = 80.5 bits (197), Expect = 5e-13 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -3 Query: 127 MEKVVNFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSSPL 2 MEKV NFVKNGELRLPPGFRFHPTDEELVVQYLKRK+FS PL Sbjct: 1 MEKV-NFVKNGELRLPPGFRFHPTDEELVVQYLKRKIFSCPL 41 >gb|KHN24977.1| NAC domain-containing protein 29 [Glycine soja] gi|947098268|gb|KRH46853.1| hypothetical protein GLYMA_08G360200 [Glycine max] Length = 224 Score = 79.7 bits (195), Expect = 8e-13 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -3 Query: 127 MEKVVNFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSSPL 2 MEKV NFVKNGELRLPPGFRFHPTDEELV+QYLKRKVFS PL Sbjct: 1 MEKV-NFVKNGELRLPPGFRFHPTDEELVLQYLKRKVFSCPL 41 >ref|XP_014498272.1| PREDICTED: NAC domain-containing protein 83-like [Vigna radiata var. radiata] Length = 232 Score = 79.3 bits (194), Expect = 1e-12 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -3 Query: 127 MEKVVNFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSSPL 2 MEK+ NFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFS PL Sbjct: 1 MEKL-NFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSFPL 41 >ref|XP_014496413.1| PREDICTED: NAC domain-containing protein 83-like [Vigna radiata var. radiata] Length = 232 Score = 79.3 bits (194), Expect = 1e-12 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -3 Query: 127 MEKVVNFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSSPL 2 MEK+ NFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFS PL Sbjct: 1 MEKL-NFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSFPL 41 >gb|KOM28456.1| hypothetical protein LR48_Vigan549s001100 [Vigna angularis] Length = 232 Score = 79.3 bits (194), Expect = 1e-12 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -3 Query: 127 MEKVVNFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSSPL 2 MEK+ NFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFS PL Sbjct: 1 MEKL-NFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSFPL 41 >ref|XP_007139098.1| hypothetical protein PHAVU_008G001000g [Phaseolus vulgaris] gi|561012231|gb|ESW11092.1| hypothetical protein PHAVU_008G001000g [Phaseolus vulgaris] Length = 241 Score = 79.3 bits (194), Expect = 1e-12 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -3 Query: 127 MEKVVNFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSSPL 2 MEK+ NFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFS PL Sbjct: 1 MEKL-NFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSFPL 41 >ref|XP_007139097.1| hypothetical protein PHAVU_008G001000g [Phaseolus vulgaris] gi|561012230|gb|ESW11091.1| hypothetical protein PHAVU_008G001000g [Phaseolus vulgaris] Length = 240 Score = 79.3 bits (194), Expect = 1e-12 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = -3 Query: 127 MEKVVNFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSSPL 2 MEK+ NFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFS PL Sbjct: 1 MEKL-NFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSFPL 41 >gb|ACU14039.1| unknown [Glycine max] Length = 224 Score = 78.6 bits (192), Expect = 2e-12 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -3 Query: 127 MEKVVNFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSSPL 2 MEKV NFVKNGELRLPPGFRFHPTDEELV+QYLKR+VFS PL Sbjct: 1 MEKV-NFVKNGELRLPPGFRFHPTDEELVLQYLKRRVFSCPL 41 >ref|NP_001238630.1| NAC domain protein [Glycine max] gi|187940285|gb|ACD39373.1| NAC domain protein [Glycine max] Length = 224 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -3 Query: 115 VNFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSSPL 2 VNFVKNGELRLPPGFRFHPTDEELV+QYLKRKVFS PL Sbjct: 4 VNFVKNGELRLPPGFRFHPTDEELVLQYLKRKVFSCPL 41 >gb|ACU15279.1| unknown [Glycine max] Length = 229 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -3 Query: 127 MEKVVNFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSSPL 2 MEKV +FVKNGELRLPPGFRFHPTDEELV+QYLKRKVFS PL Sbjct: 1 MEKV-SFVKNGELRLPPGFRFHPTDEELVLQYLKRKVFSCPL 41 >ref|NP_001238078.1| NAC domain protein [Glycine max] gi|187940283|gb|ACD39372.1| NAC domain protein [Glycine max] gi|734318990|gb|KHN03193.1| NAC domain-containing protein 29 [Glycine soja] gi|947052302|gb|KRH01831.1| hypothetical protein GLYMA_18G301500 [Glycine max] Length = 229 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -3 Query: 127 MEKVVNFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSSPL 2 MEKV +FVKNGELRLPPGFRFHPTDEELV+QYLKRKVFS PL Sbjct: 1 MEKV-SFVKNGELRLPPGFRFHPTDEELVLQYLKRKVFSCPL 41 >ref|XP_010533371.1| PREDICTED: NAC domain-containing protein 18-like [Tarenaya hassleriana] gi|729440456|ref|XP_010521426.1| PREDICTED: NAC domain-containing protein 18-like [Tarenaya hassleriana] Length = 260 Score = 76.3 bits (186), Expect = 9e-12 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -3 Query: 127 MEKVVNFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSSPL 2 MEK+ NFVKNG LRLPPGFRFHPTDEELVVQYLKRKV SSPL Sbjct: 1 MEKL-NFVKNGVLRLPPGFRFHPTDEELVVQYLKRKVHSSPL 41 >gb|ALC79012.1| NAC transcription factors 35 [Manihot esculenta] Length = 254 Score = 75.9 bits (185), Expect = 1e-11 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -3 Query: 127 MEKVVNFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSSPL 2 MEK+ NFVKNG LRLPPGFRFHPTDEELVVQYLKRKVF+ PL Sbjct: 1 MEKL-NFVKNGVLRLPPGFRFHPTDEELVVQYLKRKVFACPL 41 >gb|ALC79011.1| NAC transcription factors 34 [Manihot esculenta] Length = 254 Score = 75.9 bits (185), Expect = 1e-11 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -3 Query: 127 MEKVVNFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSSPL 2 MEK+ NFVKNG LRLPPGFRFHPTDEELVVQYLKRKVF+ PL Sbjct: 1 MEKL-NFVKNGVLRLPPGFRFHPTDEELVVQYLKRKVFACPL 41 >ref|XP_002512632.1| NAC domain-containing protein, putative [Ricinus communis] gi|223548593|gb|EEF50084.1| NAC domain-containing protein, putative [Ricinus communis] Length = 254 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -3 Query: 115 VNFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSSPL 2 +NFVKNG LRLPPGFRFHPTDEELVVQYLKRKVFS PL Sbjct: 4 LNFVKNGVLRLPPGFRFHPTDEELVVQYLKRKVFSCPL 41 >ref|XP_012088760.1| PREDICTED: NAC transcription factor 25 [Jatropha curcas] gi|495025389|gb|AGL39667.1| NAC transcription factor 011 [Jatropha curcas] gi|643708375|gb|KDP23291.1| hypothetical protein JCGZ_23124 [Jatropha curcas] Length = 251 Score = 75.9 bits (185), Expect = 1e-11 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -3 Query: 127 MEKVVNFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSSPL 2 MEK+ NFVKNG LRLPPGFRFHPTDEELVVQYLKRKVF+ PL Sbjct: 1 MEKL-NFVKNGVLRLPPGFRFHPTDEELVVQYLKRKVFACPL 41 >ref|XP_004140548.1| PREDICTED: NAC domain-containing protein 18 [Cucumis sativus] gi|700191224|gb|KGN46428.1| hypothetical protein Csa_6G092010 [Cucumis sativus] Length = 257 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -3 Query: 115 VNFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSSPL 2 +NFVKNG LRLPPGFRFHPTDEELVVQYLKRKVFS PL Sbjct: 4 LNFVKNGVLRLPPGFRFHPTDEELVVQYLKRKVFSCPL 41 >ref|XP_010090688.1| NAC domain-containing protein 29 [Morus notabilis] gi|587850163|gb|EXB40352.1| NAC domain-containing protein 29 [Morus notabilis] Length = 277 Score = 75.5 bits (184), Expect = 1e-11 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = -3 Query: 127 MEKVVNFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSSPL 2 MEK+ NFVKNG LRLPPGFRFHPTDEELVVQYLKRK FS PL Sbjct: 1 MEKL-NFVKNGVLRLPPGFRFHPTDEELVVQYLKRKAFSHPL 41 >ref|XP_011020822.1| PREDICTED: NAC transcription factor ONAC010-like [Populus euphratica] Length = 255 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -3 Query: 127 MEKVVNFVKNGELRLPPGFRFHPTDEELVVQYLKRKVFSSPL 2 MEK+ NFVKNG +RLPPGFRFHPTDEELVVQYLKRKVF+ PL Sbjct: 1 MEKL-NFVKNGAVRLPPGFRFHPTDEELVVQYLKRKVFACPL 41