BLASTX nr result
ID: Wisteria21_contig00004340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00004340 (580 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003622653.1| DUF2348 family protein [Medicago truncatula]... 58 3e-06 >ref|XP_003622653.1| DUF2348 family protein [Medicago truncatula] gi|355497668|gb|AES78871.1| DUF2348 family protein [Medicago truncatula] Length = 191 Score = 58.2 bits (139), Expect = 3e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -3 Query: 107 MEPKDLNLLNEALGLHINNNNLYGRFVLVEDCVDT 3 ME K+LNLLNE+LG + NNNNLYG+FVLVED VDT Sbjct: 1 MEQKELNLLNESLGFNNNNNNLYGQFVLVEDTVDT 35