BLASTX nr result
ID: Wisteria21_contig00004100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00004100 (304 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004504583.1| PREDICTED: protein OBERON 3 [Cicer arietinum] 64 6e-08 >ref|XP_004504583.1| PREDICTED: protein OBERON 3 [Cicer arietinum] Length = 801 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -2 Query: 108 MIASKDLRNGGVDSEGENSRSKLSRHNFEPSKEYPD 1 MIASKDLRNG +SEGENSRSKLSR NFEP+K YPD Sbjct: 1 MIASKDLRNGVAESEGENSRSKLSRPNFEPNKRYPD 36