BLASTX nr result
ID: Wisteria21_contig00002993
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00002993 (481 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004495903.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 80 4e-13 ref|XP_006574529.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 80 8e-13 gb|ACU15919.1| unknown [Glycine max] 80 8e-13 gb|AFK48388.1| unknown [Lotus japonicus] 79 1e-12 ref|XP_003625971.2| cytochrome C oxidase subunit 5C [Medicago tr... 79 2e-12 gb|AFK47757.1| unknown [Medicago truncatula] 79 2e-12 ref|XP_003591400.1| cytochrome C oxidase subunit 5C [Medicago tr... 78 3e-12 ref|XP_003535930.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 77 5e-12 gb|KHN30639.1| Cytochrome c oxidase subunit 5C-2 [Glycine soja] 76 1e-11 ref|XP_007145147.1| hypothetical protein PHAVU_007G214100g [Phas... 76 1e-11 ref|XP_008781111.1| PREDICTED: cytochrome c oxidase subunit 5C [... 75 1e-11 ref|XP_006577164.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 75 2e-11 ref|XP_006577163.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 75 2e-11 ref|XP_006577165.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 75 2e-11 ref|XP_003521595.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 75 2e-11 ref|NP_182260.1| cytochrome c oxidase subunit Vc family protein ... 75 2e-11 sp|Q8VY39.1|CX5C2_HELAN RecName: Full=Cytochrome c oxidase subun... 75 2e-11 ref|XP_010921492.1| PREDICTED: cytochrome c oxidase subunit 5C i... 75 2e-11 ref|XP_010921491.1| PREDICTED: cytochrome c oxidase subunit 5C i... 75 2e-11 gb|AGE46018.1| cytochrome c oxidase subunit 5C [Elaeis guineensis] 75 2e-11 >ref|XP_004495903.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Cicer arietinum] Length = 64 Score = 80.5 bits (197), Expect = 4e-13 Identities = 39/52 (75%), Positives = 40/52 (76%) Frame = -1 Query: 481 GPSVVKEXXXXXXXXXXXGSVWKMHHWNEQRKTRTFYDLLEKGEISVVQEEE 326 GPSVVKE GSVWKMHHWNEQRKTRTFYDLLEKGEISV+ EEE Sbjct: 13 GPSVVKEIIIGITLGIAAGSVWKMHHWNEQRKTRTFYDLLEKGEISVIAEEE 64 >ref|XP_006574529.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Glycine max] gi|734338021|gb|KHN08636.1| Cytochrome c oxidase subunit 5C-2 [Glycine soja] gi|947121012|gb|KRH69218.1| hypothetical protein GLYMA_02G012400 [Glycine max] Length = 64 Score = 79.7 bits (195), Expect = 8e-13 Identities = 39/52 (75%), Positives = 40/52 (76%) Frame = -1 Query: 481 GPSVVKEXXXXXXXXXXXGSVWKMHHWNEQRKTRTFYDLLEKGEISVVQEEE 326 GPSVVKE GSVWKMHHWNEQRKTRTFYDLLEKGEISVV EE+ Sbjct: 13 GPSVVKEIIIGITLGLAAGSVWKMHHWNEQRKTRTFYDLLEKGEISVVAEEQ 64 >gb|ACU15919.1| unknown [Glycine max] Length = 64 Score = 79.7 bits (195), Expect = 8e-13 Identities = 39/52 (75%), Positives = 40/52 (76%) Frame = -1 Query: 481 GPSVVKEXXXXXXXXXXXGSVWKMHHWNEQRKTRTFYDLLEKGEISVVQEEE 326 GPSVVKE GSVWKMHHWNEQRKTRTFYDLLEKGEISVV EE+ Sbjct: 13 GPSVVKEIIIGITLGLAAGSVWKMHHWNEQRKTRTFYDLLEKGEISVVAEEQ 64 >gb|AFK48388.1| unknown [Lotus japonicus] Length = 64 Score = 79.3 bits (194), Expect = 1e-12 Identities = 39/52 (75%), Positives = 39/52 (75%) Frame = -1 Query: 481 GPSVVKEXXXXXXXXXXXGSVWKMHHWNEQRKTRTFYDLLEKGEISVVQEEE 326 GPSVVKE GSVWKMHHWNEQRKTRTFYDLLEKGEI VV EEE Sbjct: 13 GPSVVKEIVIGMVLGLAAGSVWKMHHWNEQRKTRTFYDLLEKGEIGVVAEEE 64 >ref|XP_003625971.2| cytochrome C oxidase subunit 5C [Medicago truncatula] gi|657380182|gb|AES82189.2| cytochrome C oxidase subunit 5C [Medicago truncatula] Length = 117 Score = 78.6 bits (192), Expect = 2e-12 Identities = 38/52 (73%), Positives = 40/52 (76%) Frame = -1 Query: 481 GPSVVKEXXXXXXXXXXXGSVWKMHHWNEQRKTRTFYDLLEKGEISVVQEEE 326 GPSVVKE GSVWKMHHWNEQRKTRTF+DLLEKGEISV+ EEE Sbjct: 66 GPSVVKEICIGIVLGLAAGSVWKMHHWNEQRKTRTFHDLLEKGEISVIAEEE 117 >gb|AFK47757.1| unknown [Medicago truncatula] Length = 64 Score = 78.6 bits (192), Expect = 2e-12 Identities = 38/52 (73%), Positives = 40/52 (76%) Frame = -1 Query: 481 GPSVVKEXXXXXXXXXXXGSVWKMHHWNEQRKTRTFYDLLEKGEISVVQEEE 326 GPSVVKE GSVWKMHHWNEQRKTRTF+DLLEKGEISV+ EEE Sbjct: 13 GPSVVKEICIGIVLGLAAGSVWKMHHWNEQRKTRTFHDLLEKGEISVIAEEE 64 >ref|XP_003591400.1| cytochrome C oxidase subunit 5C [Medicago truncatula] gi|355480448|gb|AES61651.1| cytochrome C oxidase subunit 5C [Medicago truncatula] Length = 64 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/52 (73%), Positives = 39/52 (75%) Frame = -1 Query: 481 GPSVVKEXXXXXXXXXXXGSVWKMHHWNEQRKTRTFYDLLEKGEISVVQEEE 326 GPSVVKE G VWKMHHWNEQRKTRTFYDLLEKGEISVV +EE Sbjct: 13 GPSVVKEIIIGITLGLVAGGVWKMHHWNEQRKTRTFYDLLEKGEISVVVDEE 64 >ref|XP_003535930.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Glycine max] gi|947083072|gb|KRH31793.1| hypothetical protein GLYMA_10G012800 [Glycine max] Length = 64 Score = 77.0 bits (188), Expect = 5e-12 Identities = 37/52 (71%), Positives = 39/52 (75%) Frame = -1 Query: 481 GPSVVKEXXXXXXXXXXXGSVWKMHHWNEQRKTRTFYDLLEKGEISVVQEEE 326 GPSVVKE G VWKMHHWNEQRKTRTFYDLLEKGEI+VV EE+ Sbjct: 13 GPSVVKEIIIGITLGLAAGGVWKMHHWNEQRKTRTFYDLLEKGEITVVAEEQ 64 >gb|KHN30639.1| Cytochrome c oxidase subunit 5C-2 [Glycine soja] Length = 64 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/52 (69%), Positives = 39/52 (75%) Frame = -1 Query: 481 GPSVVKEXXXXXXXXXXXGSVWKMHHWNEQRKTRTFYDLLEKGEISVVQEEE 326 GPSVVK+ G VWKMHHWNEQRKTRTFYDLLEKGEI+VV EE+ Sbjct: 13 GPSVVKDIIIGITLGLAAGGVWKMHHWNEQRKTRTFYDLLEKGEITVVAEEQ 64 >ref|XP_007145147.1| hypothetical protein PHAVU_007G214100g [Phaseolus vulgaris] gi|561018337|gb|ESW17141.1| hypothetical protein PHAVU_007G214100g [Phaseolus vulgaris] Length = 64 Score = 75.9 bits (185), Expect = 1e-11 Identities = 37/52 (71%), Positives = 38/52 (73%) Frame = -1 Query: 481 GPSVVKEXXXXXXXXXXXGSVWKMHHWNEQRKTRTFYDLLEKGEISVVQEEE 326 GPSVVKE GSVWKMHHWNEQRK RTFYDLLEKGEI VV EE+ Sbjct: 13 GPSVVKEIIIGTVLGLAAGSVWKMHHWNEQRKVRTFYDLLEKGEIGVVLEEQ 64 >ref|XP_008781111.1| PREDICTED: cytochrome c oxidase subunit 5C [Phoenix dactylifera] Length = 63 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = -1 Query: 481 GPSVVKEXXXXXXXXXXXGSVWKMHHWNEQRKTRTFYDLLEKGEISVVQEE 329 GP+VVKE GS+WKMHHWNEQRKTRTFYD+LEKGEISVV EE Sbjct: 13 GPNVVKEICIGLALGLFAGSLWKMHHWNEQRKTRTFYDMLEKGEISVVVEE 63 >ref|XP_006577164.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X3 [Glycine max] Length = 68 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/52 (71%), Positives = 38/52 (73%) Frame = -1 Query: 481 GPSVVKEXXXXXXXXXXXGSVWKMHHWNEQRKTRTFYDLLEKGEISVVQEEE 326 GPSVVKE GSVWKMHHWNEQRKTR FYDLLEK EISVV +EE Sbjct: 17 GPSVVKEICIGMVLGLAAGSVWKMHHWNEQRKTRAFYDLLEKDEISVVADEE 68 >ref|XP_006577163.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X2 [Glycine max] gi|947120014|gb|KRH68263.1| hypothetical protein GLYMA_03G219600 [Glycine max] Length = 95 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/52 (71%), Positives = 38/52 (73%) Frame = -1 Query: 481 GPSVVKEXXXXXXXXXXXGSVWKMHHWNEQRKTRTFYDLLEKGEISVVQEEE 326 GPSVVKE GSVWKMHHWNEQRKTR FYDLLEK EISVV +EE Sbjct: 44 GPSVVKEICIGMVLGLAAGSVWKMHHWNEQRKTRAFYDLLEKDEISVVADEE 95 >ref|XP_006577165.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X4 [Glycine max] gi|571446705|ref|XP_006577166.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X5 [Glycine max] Length = 64 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/52 (71%), Positives = 38/52 (73%) Frame = -1 Query: 481 GPSVVKEXXXXXXXXXXXGSVWKMHHWNEQRKTRTFYDLLEKGEISVVQEEE 326 GPSVVKE GSVWKMHHWNEQRKTR FYDLLEK EISVV +EE Sbjct: 13 GPSVVKEICIGMVLGLAAGSVWKMHHWNEQRKTRAFYDLLEKDEISVVADEE 64 >ref|XP_003521595.1| PREDICTED: cytochrome c oxidase subunit 5C-like isoform X1 [Glycine max] gi|734370271|gb|KHN19213.1| Cytochrome c oxidase subunit 5C [Glycine soja] gi|947120015|gb|KRH68264.1| hypothetical protein GLYMA_03G219600 [Glycine max] Length = 103 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/52 (71%), Positives = 38/52 (73%) Frame = -1 Query: 481 GPSVVKEXXXXXXXXXXXGSVWKMHHWNEQRKTRTFYDLLEKGEISVVQEEE 326 GPSVVKE GSVWKMHHWNEQRKTR FYDLLEK EISVV +EE Sbjct: 52 GPSVVKEICIGMVLGLAAGSVWKMHHWNEQRKTRAFYDLLEKDEISVVADEE 103 >ref|NP_182260.1| cytochrome c oxidase subunit Vc family protein [Arabidopsis thaliana] gi|48427900|sp|O22912.1|CX5C1_ARATH RecName: Full=Probable cytochrome c oxidase subunit 5C-1; AltName: Full=Cytochrome c oxidase polypeptide Vc-1 gi|2275216|gb|AAB63838.1| putative cytochrome c oxidase Vc subunit [Arabidopsis thaliana] gi|17979511|gb|AAL50091.1| At2g47380/T8I13.22 [Arabidopsis thaliana] gi|20147289|gb|AAM10358.1| At2g47380/T8I13.22 [Arabidopsis thaliana] gi|330255740|gb|AEC10834.1| cytochrome c oxidase subunit Vc family protein [Arabidopsis thaliana] Length = 64 Score = 74.7 bits (182), Expect = 2e-11 Identities = 36/52 (69%), Positives = 38/52 (73%) Frame = -1 Query: 481 GPSVVKEXXXXXXXXXXXGSVWKMHHWNEQRKTRTFYDLLEKGEISVVQEEE 326 GPSVVKE G +WKMHHWNEQRKTRTFYDLLE+GEISVV EE Sbjct: 13 GPSVVKELFIGLALGLAAGGLWKMHHWNEQRKTRTFYDLLERGEISVVAAEE 64 >sp|Q8VY39.1|CX5C2_HELAN RecName: Full=Cytochrome c oxidase subunit 5C-2; AltName: Full=Cytochrome c oxidase polypeptide Vc-2 [Helianthus annuus] gi|18409602|gb|AAL67939.1| cytochrome c oxidase subunit 5c [Helianthus annuus] Length = 64 Score = 74.7 bits (182), Expect = 2e-11 Identities = 36/52 (69%), Positives = 38/52 (73%) Frame = -1 Query: 481 GPSVVKEXXXXXXXXXXXGSVWKMHHWNEQRKTRTFYDLLEKGEISVVQEEE 326 GPSVVKE G +WKMHHWNEQRKTR FYDLLEKGEISVV +EE Sbjct: 13 GPSVVKELVIGTVLGLAAGGLWKMHHWNEQRKTRAFYDLLEKGEISVVVDEE 64 >ref|XP_010921492.1| PREDICTED: cytochrome c oxidase subunit 5C isoform X2 [Elaeis guineensis] Length = 63 Score = 74.7 bits (182), Expect = 2e-11 Identities = 36/51 (70%), Positives = 38/51 (74%) Frame = -1 Query: 481 GPSVVKEXXXXXXXXXXXGSVWKMHHWNEQRKTRTFYDLLEKGEISVVQEE 329 GPSVVKE GS+WKMHHWNEQRKTR FYD+LEKGEISVV EE Sbjct: 13 GPSVVKEICIGITLGLFAGSLWKMHHWNEQRKTRAFYDMLEKGEISVVVEE 63 >ref|XP_010921491.1| PREDICTED: cytochrome c oxidase subunit 5C isoform X1 [Elaeis guineensis] Length = 106 Score = 74.7 bits (182), Expect = 2e-11 Identities = 36/51 (70%), Positives = 38/51 (74%) Frame = -1 Query: 481 GPSVVKEXXXXXXXXXXXGSVWKMHHWNEQRKTRTFYDLLEKGEISVVQEE 329 GPSVVKE GS+WKMHHWNEQRKTR FYD+LEKGEISVV EE Sbjct: 56 GPSVVKEICIGITLGLFAGSLWKMHHWNEQRKTRAFYDMLEKGEISVVVEE 106 >gb|AGE46018.1| cytochrome c oxidase subunit 5C [Elaeis guineensis] Length = 63 Score = 74.7 bits (182), Expect = 2e-11 Identities = 36/51 (70%), Positives = 38/51 (74%) Frame = -1 Query: 481 GPSVVKEXXXXXXXXXXXGSVWKMHHWNEQRKTRTFYDLLEKGEISVVQEE 329 GPSVVKE GS+WKMHHWNEQRKTR FYD+LEKGEISVV EE Sbjct: 13 GPSVVKEIFIGITLGLFAGSLWKMHHWNEQRKTRAFYDMLEKGEISVVVEE 63