BLASTX nr result
ID: Wisteria21_contig00001951
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Wisteria21_contig00001951 (366 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014512419.1| PREDICTED: probable histone H2B.3 [Vigna rad... 100 4e-19 ref|XP_010109932.1| Histone H2B.3 [Morus notabilis] gi|587938141... 100 4e-19 ref|XP_012471398.1| PREDICTED: histone H2B [Gossypium raimondii]... 100 4e-19 ref|XP_012461908.1| PREDICTED: histone H2B-like [Gossypium raimo... 100 4e-19 ref|XP_012468377.1| PREDICTED: probable histone H2B.3 [Gossypium... 100 4e-19 gb|KJB83791.1| hypothetical protein B456_013G264700 [Gossypium r... 100 4e-19 ref|XP_012444709.1| PREDICTED: histone H2B-like [Gossypium raimo... 100 4e-19 ref|XP_012471389.1| PREDICTED: probable histone H2B.1 [Gossypium... 100 4e-19 gb|KJB16909.1| hypothetical protein B456_002G253900 [Gossypium r... 100 4e-19 ref|XP_011031602.1| PREDICTED: histone H2B-like [Populus euphrat... 100 4e-19 ref|XP_011031597.1| PREDICTED: histone H2B-like [Populus euphrat... 100 4e-19 gb|KHL91135.1| hypothetical protein QW71_36400, partial [Paeniba... 100 4e-19 ref|XP_002284332.2| PREDICTED: histone H2B-like [Vitis vinifera] 100 4e-19 ref|XP_010521818.1| PREDICTED: histone H2B [Tarenaya hassleriana] 100 4e-19 ref|XP_010541381.1| PREDICTED: histone H2B.7-like [Tarenaya hass... 100 4e-19 ref|XP_010541377.1| PREDICTED: histone H2B.11-like isoform X1 [T... 100 4e-19 gb|KHG12035.1| Histone H2B [Gossypium arboreum] 100 4e-19 ref|XP_010267292.1| PREDICTED: histone H2B.3-like [Nelumbo nucif... 100 4e-19 emb|CDP09006.1| unnamed protein product [Coffea canephora] 100 4e-19 gb|KCW52702.1| hypothetical protein EUGRSUZ_J02067 [Eucalyptus g... 100 4e-19 >ref|XP_014512419.1| PREDICTED: probable histone H2B.3 [Vigna radiata var. radiata] Length = 139 Score = 100 bits (249), Expect = 4e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 49 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 98 >ref|XP_010109932.1| Histone H2B.3 [Morus notabilis] gi|587938141|gb|EXC24908.1| Histone H2B.3 [Morus notabilis] Length = 146 Score = 100 bits (249), Expect = 4e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 56 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 105 >ref|XP_012471398.1| PREDICTED: histone H2B [Gossypium raimondii] gi|7387726|sp|O22582.3|H2B_GOSHI RecName: Full=Histone H2B gi|2558962|gb|AAB97163.1| histone H2B1 [Gossypium hirsutum] gi|763752774|gb|KJB20162.1| hypothetical protein B456_003G136000 [Gossypium raimondii] Length = 147 Score = 100 bits (249), Expect = 4e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 57 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 106 >ref|XP_012461908.1| PREDICTED: histone H2B-like [Gossypium raimondii] Length = 288 Score = 100 bits (249), Expect = 4e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 198 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 247 Score = 99.0 bits (245), Expect = 1e-18 Identities = 49/49 (100%), Positives = 49/49 (100%) Frame = -2 Query: 149 ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 58 ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 106 >ref|XP_012468377.1| PREDICTED: probable histone H2B.3 [Gossypium raimondii] Length = 138 Score = 100 bits (249), Expect = 4e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 48 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 97 >gb|KJB83791.1| hypothetical protein B456_013G264700 [Gossypium raimondii] Length = 142 Score = 100 bits (249), Expect = 4e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 57 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 106 >ref|XP_012444709.1| PREDICTED: histone H2B-like [Gossypium raimondii] gi|763788708|gb|KJB55704.1| hypothetical protein B456_009G089900 [Gossypium raimondii] Length = 141 Score = 100 bits (249), Expect = 4e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 51 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 100 >ref|XP_012471389.1| PREDICTED: probable histone H2B.1 [Gossypium raimondii] gi|763752764|gb|KJB20152.1| hypothetical protein B456_003G135400 [Gossypium raimondii] Length = 147 Score = 100 bits (249), Expect = 4e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 57 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 106 >gb|KJB16909.1| hypothetical protein B456_002G253900 [Gossypium raimondii] Length = 217 Score = 100 bits (249), Expect = 4e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 127 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 176 >ref|XP_011031602.1| PREDICTED: histone H2B-like [Populus euphratica] Length = 139 Score = 100 bits (249), Expect = 4e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 49 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 98 >ref|XP_011031597.1| PREDICTED: histone H2B-like [Populus euphratica] Length = 140 Score = 100 bits (249), Expect = 4e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 50 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 99 >gb|KHL91135.1| hypothetical protein QW71_36400, partial [Paenibacillus sp. IHB B 3415] Length = 121 Score = 100 bits (249), Expect = 4e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 31 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 80 >ref|XP_002284332.2| PREDICTED: histone H2B-like [Vitis vinifera] Length = 289 Score = 100 bits (249), Expect = 4e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 57 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 106 Score = 99.4 bits (246), Expect = 1e-18 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARY Sbjct: 199 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARY 248 >ref|XP_010521818.1| PREDICTED: histone H2B [Tarenaya hassleriana] Length = 151 Score = 100 bits (249), Expect = 4e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 61 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 110 >ref|XP_010541381.1| PREDICTED: histone H2B.7-like [Tarenaya hassleriana] Length = 145 Score = 100 bits (249), Expect = 4e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 55 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 104 >ref|XP_010541377.1| PREDICTED: histone H2B.11-like isoform X1 [Tarenaya hassleriana] gi|729344824|ref|XP_010541379.1| PREDICTED: histone H2B.11-like isoform X2 [Tarenaya hassleriana] Length = 144 Score = 100 bits (249), Expect = 4e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 54 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 103 >gb|KHG12035.1| Histone H2B [Gossypium arboreum] Length = 225 Score = 100 bits (249), Expect = 4e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 57 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 106 >ref|XP_010267292.1| PREDICTED: histone H2B.3-like [Nelumbo nucifera] Length = 148 Score = 100 bits (249), Expect = 4e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 58 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 107 >emb|CDP09006.1| unnamed protein product [Coffea canephora] Length = 148 Score = 100 bits (249), Expect = 4e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 58 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 107 >gb|KCW52702.1| hypothetical protein EUGRSUZ_J02067 [Eucalyptus grandis] Length = 112 Score = 100 bits (249), Expect = 4e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 152 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 3 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY Sbjct: 22 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARY 71