BLASTX nr result
ID: Stemona21_contig00045562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00045562 (318 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC06057.1| hypothetical protein L484_009968 [Morus notabilis] 63 5e-08 >gb|EXC06057.1| hypothetical protein L484_009968 [Morus notabilis] Length = 291 Score = 62.8 bits (151), Expect = 5e-08 Identities = 41/117 (35%), Positives = 57/117 (48%), Gaps = 21/117 (17%) Frame = +2 Query: 26 KSSIIEDKD---FFLLDLP------------------PSSHVPESNLESNPNTKPIXXXX 142 ++S++EDKD F LLDLP P+ +VP + NPN +P Sbjct: 125 ENSVMEDKDKAYFLLLDLPSSPLHVSRQPSPMDVSTEPTENVPPTEPIENPNPEP----- 179 Query: 143 XXXXXXXXXXKDNRTLDHVRYGKGKVYSRKQGPTPDSMQAQTSNPTSENEVTVCEPT 313 N LD VR+GKGKV+SR++ P+ +Q Q SN ENEVT+ P+ Sbjct: 180 ------PVNPPTNPALDSVRFGKGKVFSRRKKVVPEFVQVQDSNLNLENEVTISNPS 230