BLASTX nr result
ID: Stemona21_contig00041318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00041318 (298 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB50947.1| putative galacturonosyltransferase 12 [Morus nota... 56 4e-06 gb|EMJ15103.1| hypothetical protein PRUPE_ppa004043mg [Prunus pe... 56 4e-06 >gb|EXB50947.1| putative galacturonosyltransferase 12 [Morus notabilis] Length = 533 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +2 Query: 206 MQLQISPSLRHVTVFTGKGVREFIKVKVTSR 298 MQL ISPSLRHVTVF GKGVREFIKVKV SR Sbjct: 1 MQLHISPSLRHVTVFPGKGVREFIKVKVGSR 31 >gb|EMJ15103.1| hypothetical protein PRUPE_ppa004043mg [Prunus persica] Length = 533 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +2 Query: 206 MQLQISPSLRHVTVFTGKGVREFIKVKVTSR 298 MQL ISPSLRHVTVF GKGVREFIKVKV SR Sbjct: 1 MQLHISPSLRHVTVFPGKGVREFIKVKVGSR 31