BLASTX nr result
ID: Stemona21_contig00040636
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00040636 (277 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006840418.1| hypothetical protein AMTR_s00045p00157300, p... 64 2e-08 dbj|BAF98996.1| nucleoporin 98 [Daucus carota] 57 3e-06 ref|XP_004173129.1| PREDICTED: nuclear pore complex protein Nup9... 55 7e-06 ref|XP_004236952.1| PREDICTED: nuclear pore complex protein Nup9... 55 1e-05 >ref|XP_006840418.1| hypothetical protein AMTR_s00045p00157300, partial [Amborella trichopoda] gi|548842136|gb|ERN02093.1| hypothetical protein AMTR_s00045p00157300, partial [Amborella trichopoda] Length = 1086 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/54 (62%), Positives = 36/54 (66%) Frame = +1 Query: 1 EDYQRGDKGGPNAAGQPLGGTSFAAPIQGGLFGSTSTFSQPAPNPFASPTSSNI 162 EDYQ GDKGGP+ AGQP GG F P Q FG F Q APNPF+S TSSNI Sbjct: 382 EDYQLGDKGGPSPAGQPAGGL-FGQPSQPSPFGG-GAFGQTAPNPFSSSTSSNI 433 >dbj|BAF98996.1| nucleoporin 98 [Daucus carota] Length = 1005 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 2/55 (3%) Frame = +1 Query: 1 EDYQRGDKGGPNAAGQPLGGTSFAAPIQGGLFGSTSTFSQPA--PNPFASPTSSN 159 EDYQ GDKGGPN+A QP G F Q F S+STF Q + NPF+S ++N Sbjct: 365 EDYQLGDKGGPNSAAQPAGAAGFGTNTQPNPFSSSSTFGQASAPANPFSSNNATN 419 >ref|XP_004173129.1| PREDICTED: nuclear pore complex protein Nup98-Nup96-like, partial [Cucumis sativus] Length = 436 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/53 (52%), Positives = 33/53 (62%) Frame = +1 Query: 1 EDYQRGDKGGPNAAGQPLGGTSFAAPIQGGLFGSTSTFSQPAPNPFASPTSSN 159 EDYQ GDKGGP AGQ G F P S+STFSQ +PNPF++ T +N Sbjct: 181 EDYQLGDKGGPLPAGQSASGVGFGVPGGQPNPVSSSTFSQSSPNPFSTSTPTN 233 >ref|XP_004236952.1| PREDICTED: nuclear pore complex protein Nup98-Nup96-like [Solanum lycopersicum] Length = 994 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/53 (54%), Positives = 32/53 (60%) Frame = +1 Query: 1 EDYQRGDKGGPNAAGQPLGGTSFAAPIQGGLFGSTSTFSQPAPNPFASPTSSN 159 EDYQ GDKGGP AGQ GG +F + STS F Q + NPF S TSSN Sbjct: 339 EDYQLGDKGGPAPAGQSTGGINFGSSAFAS--SSTSPFGQSSANPFTSSTSSN 389