BLASTX nr result
ID: Stemona21_contig00039813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00039813 (352 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAC55157.1| purple acid phosphatase [Nicotiana tabacum] 71 2e-10 dbj|BAC55156.1| purple acid phosphatase [Nicotiana tabacum] 71 2e-10 ref|XP_006586710.1| PREDICTED: uncharacterized protein LOC100815... 70 2e-10 ref|XP_002313026.2| hypothetical protein POPTR_0009s12400g [Popu... 70 2e-10 ref|XP_006838700.1| hypothetical protein AMTR_s00002p00249280 [A... 70 2e-10 gb|EOX97909.1| Purple acid phosphatase 10 [Theobroma cacao] 70 2e-10 gb|AFH08750.1| purple acid phosphatase 14 [Glycine max] 70 2e-10 sp|Q09131.2|PPAF_SOYBN RecName: Full=Purple acid phosphatase; Al... 70 2e-10 ref|NP_001240926.1| uncharacterized protein LOC100807555 precurs... 70 2e-10 gb|ADM16565.2| purple acid phosphatase precursor [Euphorbia char... 70 2e-10 emb|CBI38021.3| unnamed protein product [Vitis vinifera] 70 2e-10 ref|NP_001242830.1| uncharacterized protein LOC100815854 precurs... 70 2e-10 ref|XP_002264224.1| PREDICTED: purple acid phosphatase 2 isoform... 70 2e-10 ref|XP_002263971.1| PREDICTED: purple acid phosphatase 2 isoform... 70 2e-10 ref|XP_002264050.1| PREDICTED: purple acid phosphatase 2 isoform... 70 2e-10 ref|XP_002263937.1| PREDICTED: purple acid phosphatase 2 isoform... 70 2e-10 ref|XP_002264113.1| PREDICTED: purple acid phosphatase 2 isoform... 70 2e-10 emb|CAN75519.1| hypothetical protein VITISV_011076 [Vitis vinifera] 70 2e-10 ref|XP_002512962.1| Purple acid phosphatase precursor, putative ... 69 5e-10 ref|XP_006487340.1| PREDICTED: purple acid phosphatase 2-like [C... 69 7e-10 >dbj|BAC55157.1| purple acid phosphatase [Nicotiana tabacum] Length = 470 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/45 (75%), Positives = 37/45 (82%), Gaps = 5/45 (11%) Frame = +1 Query: 1 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS-----VSAGLINKK 120 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS V+ ++N K Sbjct: 334 GETMRVMYEPWFVQYKVDVVFAGHVHAYERSERVSNVAYNIVNGK 378 >dbj|BAC55156.1| purple acid phosphatase [Nicotiana tabacum] Length = 468 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/45 (75%), Positives = 37/45 (82%), Gaps = 5/45 (11%) Frame = +1 Query: 1 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS-----VSAGLINKK 120 GETMRVMYEPWFV YKVDVVFAGHVHAYERS V+ +IN+K Sbjct: 333 GETMRVMYEPWFVNYKVDVVFAGHVHAYERSERISNVAYNIINRK 377 >ref|XP_006586710.1| PREDICTED: uncharacterized protein LOC100815854 isoform X1 [Glycine max] Length = 464 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 93 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS Sbjct: 327 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 357 >ref|XP_002313026.2| hypothetical protein POPTR_0009s12400g [Populus trichocarpa] gi|550331584|gb|EEE86981.2| hypothetical protein POPTR_0009s12400g [Populus trichocarpa] Length = 489 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 93 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS Sbjct: 353 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 383 >ref|XP_006838700.1| hypothetical protein AMTR_s00002p00249280 [Amborella trichopoda] gi|548841206|gb|ERN01269.1| hypothetical protein AMTR_s00002p00249280 [Amborella trichopoda] Length = 461 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 93 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS Sbjct: 325 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 355 >gb|EOX97909.1| Purple acid phosphatase 10 [Theobroma cacao] Length = 470 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 93 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS Sbjct: 335 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 365 >gb|AFH08750.1| purple acid phosphatase 14 [Glycine max] Length = 464 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 93 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS Sbjct: 327 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 357 >sp|Q09131.2|PPAF_SOYBN RecName: Full=Purple acid phosphatase; AltName: Full=Zinc(II) purple acid phosphatase; Flags: Precursor gi|6635439|gb|AAF19820.1|AF200824_1 purple acid phosphatase precursor [Glycine max] Length = 464 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 93 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS Sbjct: 327 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 357 >ref|NP_001240926.1| uncharacterized protein LOC100807555 precursor [Glycine max] gi|304421394|gb|ADM32496.1| phytase [Glycine max] Length = 464 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 93 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS Sbjct: 327 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 357 >gb|ADM16565.2| purple acid phosphatase precursor [Euphorbia characias] Length = 463 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 93 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS Sbjct: 327 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 357 >emb|CBI38021.3| unnamed protein product [Vitis vinifera] Length = 426 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 93 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS Sbjct: 290 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 320 >ref|NP_001242830.1| uncharacterized protein LOC100815854 precursor [Glycine max] gi|255636696|gb|ACU18684.1| unknown [Glycine max] Length = 460 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 93 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS Sbjct: 323 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 353 >ref|XP_002264224.1| PREDICTED: purple acid phosphatase 2 isoform 3 [Vitis vinifera] Length = 447 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 93 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS Sbjct: 311 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 341 >ref|XP_002263971.1| PREDICTED: purple acid phosphatase 2 isoform 2 [Vitis vinifera] Length = 446 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 93 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS Sbjct: 310 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 340 >ref|XP_002264050.1| PREDICTED: purple acid phosphatase 2 isoform 3 [Vitis vinifera] Length = 447 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 93 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS Sbjct: 311 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 341 >ref|XP_002263937.1| PREDICTED: purple acid phosphatase 2 isoform 1 [Vitis vinifera] gi|297744760|emb|CBI38022.3| unnamed protein product [Vitis vinifera] Length = 472 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 93 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS Sbjct: 336 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 366 >ref|XP_002264113.1| PREDICTED: purple acid phosphatase 2 isoform 1 [Vitis vinifera] Length = 472 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 93 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS Sbjct: 336 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 366 >emb|CAN75519.1| hypothetical protein VITISV_011076 [Vitis vinifera] Length = 403 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 93 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS Sbjct: 267 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 297 >ref|XP_002512962.1| Purple acid phosphatase precursor, putative [Ricinus communis] gi|223547973|gb|EEF49465.1| Purple acid phosphatase precursor, putative [Ricinus communis] Length = 467 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 5/45 (11%) Frame = +1 Query: 1 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS-----VSAGLINKK 120 GETMRVMYEPWFV+YKVDVVFAGHVHAYERS V+ ++N K Sbjct: 331 GETMRVMYEPWFVKYKVDVVFAGHVHAYERSERISNVAYNIVNGK 375 >ref|XP_006487340.1| PREDICTED: purple acid phosphatase 2-like [Citrus sinensis] Length = 468 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 GETMRVMYEPWFVQYKVDVVFAGHVHAYERS 93 GETMRVMYEPWFV+YKVDVVFAGHVHAYERS Sbjct: 332 GETMRVMYEPWFVKYKVDVVFAGHVHAYERS 362