BLASTX nr result
ID: Stemona21_contig00039674
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00039674 (289 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535305.1| conserved hypothetical protein [Ricinus comm... 122 4e-26 gb|EXC21503.1| hypothetical protein L484_014858 [Morus notabilis] 98 1e-18 gb|EXC08244.1| hypothetical protein L484_012700 [Morus notabilis] 71 1e-10 gb|EXB24696.1| hypothetical protein L484_005490 [Morus notabilis] 55 9e-06 >ref|XP_002535305.1| conserved hypothetical protein [Ricinus communis] gi|223523491|gb|EEF27078.1| conserved hypothetical protein [Ricinus communis] Length = 183 Score = 122 bits (307), Expect = 4e-26 Identities = 61/67 (91%), Positives = 61/67 (91%) Frame = +2 Query: 89 RQAVDSFFALIREGKKGPKHGRCRTLEWQRKARPYLFFQACSDIRFPRKIKLVSRVMGNL 268 RQAVDSF IREGKKGPKH RCRTLEWQRKA YLFFQACSDIRFPRKIKLVSRVMGNL Sbjct: 120 RQAVDSF---IREGKKGPKHLRCRTLEWQRKAGSYLFFQACSDIRFPRKIKLVSRVMGNL 176 Query: 269 PARFGEH 289 PARFGEH Sbjct: 177 PARFGEH 183 >gb|EXC21503.1| hypothetical protein L484_014858 [Morus notabilis] Length = 116 Score = 98.2 bits (243), Expect = 1e-18 Identities = 45/52 (86%), Positives = 47/52 (90%) Frame = +2 Query: 134 KGPKHGRCRTLEWQRKARPYLFFQACSDIRFPRKIKLVSRVMGNLPARFGEH 289 +G KHGRCRTLEWQRK R YLFFQACSDI FP KIKLVSRVMGNLPA+FGEH Sbjct: 65 EGAKHGRCRTLEWQRKTRSYLFFQACSDIWFPWKIKLVSRVMGNLPAQFGEH 116 >gb|EXC08244.1| hypothetical protein L484_012700 [Morus notabilis] Length = 255 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = +2 Query: 161 TLEWQRKARPYLFFQACSDIRFPRKIKLVSRVMGNLPARFGEH 289 TL+ + YLFFQACSDIRFPRKIKLVSR MGNLPARFGEH Sbjct: 213 TLKKMQAGMEYLFFQACSDIRFPRKIKLVSRGMGNLPARFGEH 255 >gb|EXB24696.1| hypothetical protein L484_005490 [Morus notabilis] Length = 1260 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = +1 Query: 205 GLFGHTVPAEDQVGEPCDGKPSRTVRRA 288 GLFGHTVP EDQVGE CDGKPS TVRRA Sbjct: 326 GLFGHTVPVEDQVGELCDGKPSCTVRRA 353