BLASTX nr result
ID: Stemona21_contig00038949
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00038949 (756 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT08309.1| hypothetical protein F775_09081 [Aegilops tauschii] 65 2e-08 dbj|BAK04789.1| predicted protein [Hordeum vulgare subsp. vulgare] 65 2e-08 gb|ADE76547.1| unknown [Picea sitchensis] 65 2e-08 gb|EXC10733.1| hypothetical protein L484_025317 [Morus notabilis] 65 2e-08 ref|XP_006407296.1| hypothetical protein EUTSA_v10020185mg [Eutr... 65 2e-08 gb|AFG65804.1| hypothetical protein 2_9455_01, partial [Pinus ta... 65 2e-08 ref|XP_003559929.1| PREDICTED: putative pentatricopeptide repeat... 65 2e-08 ref|XP_002884925.1| predicted protein [Arabidopsis lyrata subsp.... 65 2e-08 gb|EXB37797.1| hypothetical protein L484_002732 [Morus notabilis] 65 3e-08 ref|XP_006447804.1| hypothetical protein CICLE_v10017893mg [Citr... 65 3e-08 ref|XP_004952954.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 ref|NP_001172331.1| Os01g0355000 [Oryza sativa Japonica Group] g... 65 3e-08 gb|AFG65809.1| hypothetical protein 2_9455_01, partial [Pinus ta... 65 3e-08 gb|AFG65806.1| hypothetical protein 2_9455_01, partial [Pinus ta... 65 3e-08 gb|AFG61376.1| hypothetical protein 0_7614_01, partial [Pinus ta... 65 3e-08 gb|AEW08424.1| hypothetical protein 2_9455_01, partial [Pinus ra... 65 3e-08 gb|AEW07637.1| hypothetical protein 0_7614_01, partial [Pinus ra... 65 3e-08 gb|EAZ11837.1| hypothetical protein OsJ_01713 [Oryza sativa Japo... 65 3e-08 gb|EAY73966.1| hypothetical protein OsI_01850 [Oryza sativa Indi... 65 3e-08 gb|AEW08425.1| hypothetical protein 2_9455_01, partial [Pinus la... 64 4e-08 >gb|EMT08309.1| hypothetical protein F775_09081 [Aegilops tauschii] Length = 877 Score = 65.5 bits (158), Expect = 2e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 756 FISKIVGREIVVRDLNRFHYFTDGVCSCGDYW 661 FISKIV REI++RD+NRFH+F+DG CSCGDYW Sbjct: 846 FISKIVSREIIIRDINRFHHFSDGACSCGDYW 877 >dbj|BAK04789.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 879 Score = 65.5 bits (158), Expect = 2e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 756 FISKIVGREIVVRDLNRFHYFTDGVCSCGDYW 661 FISKIV REI++RD+NRFH+F+DG CSCGDYW Sbjct: 848 FISKIVSREIIIRDINRFHHFSDGACSCGDYW 879 >gb|ADE76547.1| unknown [Picea sitchensis] Length = 210 Score = 65.5 bits (158), Expect = 2e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 756 FISKIVGREIVVRDLNRFHYFTDGVCSCGDYW 661 FISKI GREIVVRD NRFH+F DG+CSCGDYW Sbjct: 179 FISKIAGREIVVRDANRFHHFKDGLCSCGDYW 210 >gb|EXC10733.1| hypothetical protein L484_025317 [Morus notabilis] Length = 659 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 756 FISKIVGREIVVRDLNRFHYFTDGVCSCGDYW 661 FISK V REIVVRD+NRFH+F DGVCSCGDYW Sbjct: 628 FISKFVNREIVVRDVNRFHHFRDGVCSCGDYW 659 >ref|XP_006407296.1| hypothetical protein EUTSA_v10020185mg [Eutrema salsugineum] gi|557108442|gb|ESQ48749.1| hypothetical protein EUTSA_v10020185mg [Eutrema salsugineum] Length = 694 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 753 ISKIVGREIVVRDLNRFHYFTDGVCSCGDYW 661 ISK+VGREIVVRD NRFH+F DGVCSCGDYW Sbjct: 664 ISKLVGREIVVRDTNRFHHFKDGVCSCGDYW 694 >gb|AFG65804.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165802|gb|AFG65805.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165820|gb|AFG65814.1| hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 65.1 bits (157), Expect = 2e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 756 FISKIVGREIVVRDLNRFHYFTDGVCSCGDYW 661 FISK+VGREI++RD NRFH+F DG+CSCGDYW Sbjct: 125 FISKVVGREIIMRDANRFHHFKDGLCSCGDYW 156 >ref|XP_003559929.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330-like [Brachypodium distachyon] Length = 646 Score = 65.1 bits (157), Expect = 2e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 756 FISKIVGREIVVRDLNRFHYFTDGVCSCGDYW 661 FISKIVGREIV+RD NRFH+F DG+CSCGD+W Sbjct: 615 FISKIVGREIVMRDANRFHHFKDGICSCGDFW 646 >ref|XP_002884925.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297330765|gb|EFH61184.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 694 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 753 ISKIVGREIVVRDLNRFHYFTDGVCSCGDYW 661 ISK+VGREIVVRD NRFH+F DGVCSCGDYW Sbjct: 664 ISKLVGREIVVRDTNRFHHFKDGVCSCGDYW 694 >gb|EXB37797.1| hypothetical protein L484_002732 [Morus notabilis] Length = 672 Score = 64.7 bits (156), Expect = 3e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 756 FISKIVGREIVVRDLNRFHYFTDGVCSCGDYW 661 FISKI REI+VRDLNRFH+FTDG CSCGDYW Sbjct: 641 FISKIFRREIIVRDLNRFHHFTDGSCSCGDYW 672 >ref|XP_006447804.1| hypothetical protein CICLE_v10017893mg [Citrus clementina] gi|568830346|ref|XP_006469462.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950-like [Citrus sinensis] gi|557550415|gb|ESR61044.1| hypothetical protein CICLE_v10017893mg [Citrus clementina] Length = 1057 Score = 64.7 bits (156), Expect = 3e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 756 FISKIVGREIVVRDLNRFHYFTDGVCSCGDYW 661 FISKIVGREIV+RD NRFH+F DG CSCGDYW Sbjct: 1026 FISKIVGREIVLRDSNRFHHFNDGKCSCGDYW 1057 >ref|XP_004952954.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Setaria italica] Length = 883 Score = 64.7 bits (156), Expect = 3e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 756 FISKIVGREIVVRDLNRFHYFTDGVCSCGDYW 661 FISKIV REI++RD+NRFH+F DG CSCGDYW Sbjct: 852 FISKIVSREIIIRDINRFHHFRDGTCSCGDYW 883 >ref|NP_001172331.1| Os01g0355000 [Oryza sativa Japonica Group] gi|53791352|dbj|BAD52598.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza sativa Japonica Group] gi|215768699|dbj|BAH00928.1| unnamed protein product [Oryza sativa Japonica Group] gi|255673214|dbj|BAH91061.1| Os01g0355000 [Oryza sativa Japonica Group] Length = 877 Score = 64.7 bits (156), Expect = 3e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 756 FISKIVGREIVVRDLNRFHYFTDGVCSCGDYW 661 FISKIV REI++RD+NRFH+F DG CSCGDYW Sbjct: 846 FISKIVSREIIIRDINRFHHFRDGTCSCGDYW 877 >gb|AFG65809.1| hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 64.7 bits (156), Expect = 3e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 756 FISKIVGREIVVRDLNRFHYFTDGVCSCGDYW 661 FISK+VGREI++RD NRFH+F DG+CSCGDYW Sbjct: 125 FISKVVGREIIMRDSNRFHHFKDGLCSCGDYW 156 >gb|AFG65806.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165806|gb|AFG65807.1| hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 64.7 bits (156), Expect = 3e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 756 FISKIVGREIVVRDLNRFHYFTDGVCSCGDYW 661 FISK+VGREI++RD NRFH+F DG+CSCGDYW Sbjct: 125 FISKVVGREIIMRDSNRFHHFKDGLCSCGDYW 156 >gb|AFG61376.1| hypothetical protein 0_7614_01, partial [Pinus taeda] Length = 110 Score = 64.7 bits (156), Expect = 3e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 756 FISKIVGREIVVRDLNRFHYFTDGVCSCGDYW 661 FISKIVGREI+VRD NRFH+F +G+CSCGDYW Sbjct: 79 FISKIVGREIIVRDANRFHHFKNGLCSCGDYW 110 >gb|AEW08424.1| hypothetical protein 2_9455_01, partial [Pinus radiata] gi|383165794|gb|AFG65801.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165798|gb|AFG65803.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165808|gb|AFG65808.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165812|gb|AFG65810.1| hypothetical protein 2_9455_01, partial [Pinus taeda] gi|383165814|gb|AFG65811.1| hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 64.7 bits (156), Expect = 3e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 756 FISKIVGREIVVRDLNRFHYFTDGVCSCGDYW 661 FISK+VGREI++RD NRFH+F DG+CSCGDYW Sbjct: 125 FISKVVGREIIMRDSNRFHHFKDGLCSCGDYW 156 >gb|AEW07637.1| hypothetical protein 0_7614_01, partial [Pinus radiata] gi|383158059|gb|AFG61375.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gi|383158063|gb|AFG61377.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gi|383158065|gb|AFG61378.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gi|383158067|gb|AFG61379.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gi|383158069|gb|AFG61380.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gi|383158071|gb|AFG61381.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gi|383158073|gb|AFG61382.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gi|383158075|gb|AFG61383.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gi|383158077|gb|AFG61384.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gi|383158079|gb|AFG61385.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gi|383158081|gb|AFG61386.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gi|383158083|gb|AFG61387.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gi|383158085|gb|AFG61388.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gi|383158087|gb|AFG61389.1| hypothetical protein 0_7614_01, partial [Pinus taeda] gi|383158089|gb|AFG61390.1| hypothetical protein 0_7614_01, partial [Pinus taeda] Length = 110 Score = 64.7 bits (156), Expect = 3e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 756 FISKIVGREIVVRDLNRFHYFTDGVCSCGDYW 661 FISKIVGREI+VRD NRFH+F +G+CSCGDYW Sbjct: 79 FISKIVGREIIVRDANRFHHFKNGLCSCGDYW 110 >gb|EAZ11837.1| hypothetical protein OsJ_01713 [Oryza sativa Japonica Group] Length = 877 Score = 64.7 bits (156), Expect = 3e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 756 FISKIVGREIVVRDLNRFHYFTDGVCSCGDYW 661 FISKIV REI++RD+NRFH+F DG CSCGDYW Sbjct: 846 FISKIVSREIIIRDINRFHHFRDGTCSCGDYW 877 >gb|EAY73966.1| hypothetical protein OsI_01850 [Oryza sativa Indica Group] Length = 641 Score = 64.7 bits (156), Expect = 3e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 756 FISKIVGREIVVRDLNRFHYFTDGVCSCGDYW 661 FISKIV REI++RD+NRFH+F DG CSCGDYW Sbjct: 610 FISKIVSREIIIRDINRFHHFRDGTCSCGDYW 641 >gb|AEW08425.1| hypothetical protein 2_9455_01, partial [Pinus lambertiana] Length = 156 Score = 64.3 bits (155), Expect = 4e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 756 FISKIVGREIVVRDLNRFHYFTDGVCSCGDYW 661 FISK+VGREI++RD NRFH+F DG CSCGDYW Sbjct: 125 FISKVVGREIIMRDANRFHHFKDGFCSCGDYW 156