BLASTX nr result
ID: Stemona21_contig00037472
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00037472 (290 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006650368.1| PREDICTED: formin-like protein 14-like [Oryz... 55 7e-06 >ref|XP_006650368.1| PREDICTED: formin-like protein 14-like [Oryza brachyantha] Length = 311 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/60 (46%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = +2 Query: 5 RFRSDHRMPENCNVADIVARFENERLHVTLPKLITSP-DVMTPTRITTPSPETKPEPAEP 181 RF+ D ++P +CNV I A+FENE L +TLPK I SP +TP+ P +PEP P Sbjct: 64 RFQKDFQLPADCNVDGIRAKFENETLTITLPKKIASPTQPLTPSPSPPLPPPPQPEPRRP 123