BLASTX nr result
ID: Stemona21_contig00035908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00035908 (672 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003561371.1| PREDICTED: uncharacterized protein LOC100844... 57 5e-06 >ref|XP_003561371.1| PREDICTED: uncharacterized protein LOC100844639 [Brachypodium distachyon] Length = 129 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/59 (52%), Positives = 36/59 (61%), Gaps = 5/59 (8%) Frame = +2 Query: 23 MERGEKETAATSHQPDLHSVRKPPAKPWRR-----SETPLQPKVYHVHPRGFRRLVQRL 184 ME GE+ A H+ L +V++ PAKPWR S P PKVY V PRGFR LVQRL Sbjct: 1 MEHGERRNGA--HEAALRAVQRAPAKPWRGATGAGSLPPAPPKVYRVEPRGFRELVQRL 57