BLASTX nr result
ID: Stemona21_contig00035053
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00035053 (372 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY20099.1| Pentatricopeptide repeat (PPR) superfamily protei... 68 1e-09 ref|XP_003555011.2| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_006389884.1| hypothetical protein EUTSA_v10018121mg [Eutr... 68 1e-09 ref|XP_004245808.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_002279656.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_006359236.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_006300415.1| hypothetical protein CARUB_v10021690mg [Caps... 67 3e-09 emb|CBI22115.3| unnamed protein product [Vitis vinifera] 66 4e-09 ref|NP_178067.1| pentatricopeptide repeat-containing protein [Ar... 66 5e-09 ref|XP_002887788.1| EMB2217 [Arabidopsis lyrata subsp. lyrata] g... 66 5e-09 ref|XP_004504664.1| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 ref|XP_002316152.1| pentatricopeptide repeat-containing family p... 65 7e-09 gb|EXB51258.1| hypothetical protein L484_019251 [Morus notabilis] 65 9e-09 gb|ESW23563.1| hypothetical protein PHAVU_004G057900g [Phaseolus... 65 1e-08 ref|XP_004138818.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|NP_001053849.1| Os04g0612800 [Oryza sativa Japonica Group] g... 64 3e-08 ref|XP_006422261.1| hypothetical protein CICLE_v10004323mg [Citr... 63 4e-08 ref|XP_004306550.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_006652805.1| PREDICTED: pentatricopeptide repeat-containi... 62 8e-08 ref|XP_002448513.1| hypothetical protein SORBIDRAFT_06g028250 [S... 62 8e-08 >gb|EOY20099.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 820 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 370 NEIPSRADVLMHKLNVLFPSSAPEVRSFSPPRPMSLSKGM 251 NEIPSRAD+LMHKLN+LFPSSAPE+RS SPP+P+ + M Sbjct: 781 NEIPSRADILMHKLNILFPSSAPEIRSLSPPKPLIAGRAM 820 >ref|XP_003555011.2| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Glycine max] Length = 818 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -3 Query: 370 NEIPSRADVLMHKLNVLFPSSAPEVRSFSPPRPMSLSKGM 251 NEIPSR+D+LMHKLN+LFPSSAPE+RS SPP+P+ S+ M Sbjct: 779 NEIPSRSDILMHKLNILFPSSAPELRSLSPPKPLIASRAM 818 >ref|XP_006389884.1| hypothetical protein EUTSA_v10018121mg [Eutrema salsugineum] gi|557086318|gb|ESQ27170.1| hypothetical protein EUTSA_v10018121mg [Eutrema salsugineum] Length = 836 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -3 Query: 370 NEIPSRADVLMHKLNVLFPSSAPEVRSFSPPRPMSLSK 257 NEIPSRAD+LMHKLNV+FPSSAPE+RS SPP+P+ SK Sbjct: 797 NEIPSRADILMHKLNVMFPSSAPELRSMSPPKPLMSSK 834 >ref|XP_004245808.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Solanum lycopersicum] Length = 794 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 370 NEIPSRADVLMHKLNVLFPSSAPEVRSFSPPRPMSLSKGM 251 NEIPSRAD+LMHKLN+LFP+SAPE+RS SPP+P+ K M Sbjct: 755 NEIPSRADILMHKLNILFPTSAPEIRSLSPPKPIFAGKAM 794 >ref|XP_002279656.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Vitis vinifera] Length = 844 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 370 NEIPSRADVLMHKLNVLFPSSAPEVRSFSPPRPMSLSKGM 251 NEIPSRAD+LMHKLN LFPSSAPE+RS SPP+P+ K M Sbjct: 803 NEIPSRADILMHKLNTLFPSSAPEIRSLSPPKPLISGKAM 842 >ref|XP_006359236.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Solanum tuberosum] Length = 794 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -3 Query: 370 NEIPSRADVLMHKLNVLFPSSAPEVRSFSPPRPMSLSKGM 251 NEIPSR+D+LMHKLN+LFP+SAPE+RS SPP+P+ K M Sbjct: 755 NEIPSRSDILMHKLNILFPTSAPEIRSLSPPKPIFAGKAM 794 >ref|XP_006300415.1| hypothetical protein CARUB_v10021690mg [Capsella rubella] gi|482569125|gb|EOA33313.1| hypothetical protein CARUB_v10021690mg [Capsella rubella] Length = 836 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -3 Query: 370 NEIPSRADVLMHKLNVLFPSSAPEVRSFSPPRPMSLSK 257 NEIPSR+D+LMHKLNV+FPSSAPE+RS SPP+P+ SK Sbjct: 797 NEIPSRSDILMHKLNVMFPSSAPELRSMSPPKPLMSSK 834 >emb|CBI22115.3| unnamed protein product [Vitis vinifera] Length = 765 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 370 NEIPSRADVLMHKLNVLFPSSAPEVRSFSPPRPMSLSKGM 251 NEIPSRAD+LMHKLN LFPSSAPE+RS SPP+P+ K + Sbjct: 716 NEIPSRADILMHKLNTLFPSSAPEIRSLSPPKPLISGKAI 755 >ref|NP_178067.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75200795|sp|Q9SAK0.1|PP132_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g79490, mitochondrial; AltName: Full=Protein EMBRYO DEFECTIVE 2217; Flags: Precursor gi|4835759|gb|AAD30226.1|AC007202_8 T8K14.9 [Arabidopsis thaliana] gi|332198129|gb|AEE36250.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 836 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -3 Query: 370 NEIPSRADVLMHKLNVLFPSSAPEVRSFSPPRPMSLSK 257 NEIPSR+D+LMHK+NV+FPSSAPE+RS SPP+P+ SK Sbjct: 797 NEIPSRSDILMHKMNVMFPSSAPELRSMSPPKPLMSSK 834 >ref|XP_002887788.1| EMB2217 [Arabidopsis lyrata subsp. lyrata] gi|297333629|gb|EFH64047.1| EMB2217 [Arabidopsis lyrata subsp. lyrata] Length = 832 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -3 Query: 370 NEIPSRADVLMHKLNVLFPSSAPEVRSFSPPRPMSLSK 257 NEIPSR+D+LMHK+NV+FPSSAPE+RS SPP+P+ SK Sbjct: 793 NEIPSRSDILMHKMNVMFPSSAPELRSMSPPKPLMSSK 830 >ref|XP_004504664.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Cicer arietinum] Length = 824 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -3 Query: 370 NEIPSRADVLMHKLNVLFPSSAPEVRSFSPPRPM 269 NEIPSRAD+LMHKLN+LFP+SAPE+RS SPP+P+ Sbjct: 785 NEIPSRADILMHKLNILFPNSAPEIRSLSPPKPL 818 >ref|XP_002316152.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222865192|gb|EEF02323.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 785 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = -3 Query: 370 NEIPSRADVLMHKLNVLFPSSAPEVRSFSPPRPMSLSKGM 251 NEIPSRAD+LMH+LN+LFP+SAPE+RS SPP+P+ +K + Sbjct: 746 NEIPSRADILMHRLNILFPTSAPEIRSLSPPKPLISAKAV 785 >gb|EXB51258.1| hypothetical protein L484_019251 [Morus notabilis] Length = 834 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 370 NEIPSRADVLMHKLNVLFPSSAPEVRSFSPPRPMSLSKGM 251 NEIPS+A+VLMHKLN+LFPSSAPEVRS SPP+P+ + M Sbjct: 795 NEIPSKAEVLMHKLNILFPSSAPEVRSLSPPKPLIGGRAM 834 >gb|ESW23563.1| hypothetical protein PHAVU_004G057900g [Phaseolus vulgaris] Length = 755 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -3 Query: 370 NEIPSRADVLMHKLNVLFPSSAPEVRSFSPPRPM 269 NEIPSR+D+LMH+LN+LFPSSAPEVRS SPP+P+ Sbjct: 716 NEIPSRSDILMHRLNILFPSSAPEVRSLSPPKPL 749 >ref|XP_004138818.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Cucumis sativus] gi|449490234|ref|XP_004158545.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Cucumis sativus] Length = 823 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -3 Query: 370 NEIPSRADVLMHKLNVLFPSSAPEVRSFSPPRPM 269 NEIPSR+D+LMHKLN LFPSSAPE+RS SPP+P+ Sbjct: 784 NEIPSRSDILMHKLNTLFPSSAPEIRSLSPPKPL 817 >ref|NP_001053849.1| Os04g0612800 [Oryza sativa Japonica Group] gi|38568022|emb|CAE05207.3| OSJNBa0070C17.14 [Oryza sativa Japonica Group] gi|113565420|dbj|BAF15763.1| Os04g0612800 [Oryza sativa Japonica Group] Length = 784 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -3 Query: 370 NEIPSRADVLMHKLNVLFPSSAPEVRSFSPPRPMSLSK 257 NEIPS+ADVLMH+LNV+FPSSAPEVRS S PR +S+S+ Sbjct: 747 NEIPSKADVLMHRLNVMFPSSAPEVRSLSIPRSLSMSR 784 >ref|XP_006422261.1| hypothetical protein CICLE_v10004323mg [Citrus clementina] gi|568881878|ref|XP_006493776.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Citrus sinensis] gi|557524134|gb|ESR35501.1| hypothetical protein CICLE_v10004323mg [Citrus clementina] Length = 827 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -3 Query: 370 NEIPSRADVLMHKLNVLFPSSAPEVRSFSPPRPM 269 NEIPSRAD+LMHK+N+LFP SAPE+RS SPP+P+ Sbjct: 789 NEIPSRADILMHKMNILFPCSAPELRSLSPPKPL 822 >ref|XP_004306550.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 844 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -3 Query: 370 NEIPSRADVLMHKLNVLFPSSAPEVRSFSPPRPMSLSKGM 251 NEIPSR+D+LMHKLN LFPSSAPE+RS SPP+ + KG+ Sbjct: 805 NEIPSRSDILMHKLNTLFPSSAPELRSLSPPKMLMGRKGI 844 >ref|XP_006652805.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Oryza brachyantha] Length = 533 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -3 Query: 370 NEIPSRADVLMHKLNVLFPSSAPEVRSFSPPRPMSLSK 257 NEIPS+ADVLMH+LNV+FPSSAPEVRS S PR + +S+ Sbjct: 496 NEIPSKADVLMHRLNVMFPSSAPEVRSLSIPRSLGMSR 533 >ref|XP_002448513.1| hypothetical protein SORBIDRAFT_06g028250 [Sorghum bicolor] gi|241939696|gb|EES12841.1| hypothetical protein SORBIDRAFT_06g028250 [Sorghum bicolor] Length = 718 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -3 Query: 370 NEIPSRADVLMHKLNVLFPSSAPEVRSFSPPRPMSLSK 257 NEIPS+ADVLMH+LNV+FPSSAPEVRS S PR + +S+ Sbjct: 681 NEIPSKADVLMHRLNVMFPSSAPEVRSLSIPRSLGMSR 718