BLASTX nr result
ID: Stemona21_contig00034704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00034704 (552 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEZ00900.1| putative RNA recognition motif-containing protein... 57 4e-06 >gb|AEZ00900.1| putative RNA recognition motif-containing protein, partial [Elaeis guineensis] Length = 294 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 552 KESKHPGADPLLLCFADFNSPGQAAVALEALQ 457 KES+HPG DPL+LCF DF++P QAAVAL+ALQ Sbjct: 215 KESRHPGGDPLVLCFVDFSTPAQAAVALDALQ 246