BLASTX nr result
ID: Stemona21_contig00033941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00033941 (294 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT31929.1| hypothetical protein F775_15774 [Aegilops tauschii] 61 1e-07 >gb|EMT31929.1| hypothetical protein F775_15774 [Aegilops tauschii] Length = 453 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 159 WANLPPELLIDVAKRLSSLSDFLRFRAVCRSWRSAAELRHLRP 287 WA LPP+LL++V+ RL +D +RF AVCRSWR AA L H RP Sbjct: 11 WAGLPPDLLLEVSSRLQHAADLVRFHAVCRSWREAAALLHSRP 53