BLASTX nr result
ID: Stemona21_contig00033783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00033783 (309 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003533569.1| PREDICTED: uncharacterized protein LOC100804... 57 2e-06 gb|EMJ21374.1| hypothetical protein PRUPE_ppa016549mg [Prunus pe... 57 3e-06 >ref|XP_003533569.1| PREDICTED: uncharacterized protein LOC100804626 [Glycine max] Length = 196 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/46 (50%), Positives = 35/46 (76%) Frame = +1 Query: 169 FRFYYTLLLWIVLFVSLVPRRPISLLFFVATSAVTVVYLSVPRVFP 306 F YYTL +WI+LF++L+P+R +SL+ FV + VT +Y+ + RVFP Sbjct: 64 FGLYYTLFVWIILFITLIPQRKVSLILFVTMTYVTTLYILLLRVFP 109 >gb|EMJ21374.1| hypothetical protein PRUPE_ppa016549mg [Prunus persica] Length = 182 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/47 (51%), Positives = 35/47 (74%) Frame = +1 Query: 166 YFRFYYTLLLWIVLFVSLVPRRPISLLFFVATSAVTVVYLSVPRVFP 306 YFR YY L +W +L ++L+P+R +SL+F VA +AVT +YL + RV P Sbjct: 63 YFRLYYILFIWTILSITLLPKRKVSLIFLVAMTAVTCLYLVLLRVVP 109