BLASTX nr result
ID: Stemona21_contig00032685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00032685 (378 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275581.2| PREDICTED: pentatricopeptide repeat-containi... 108 9e-22 emb|CBI21289.3| unnamed protein product [Vitis vinifera] 108 9e-22 gb|ABF96424.1| pentatricopeptide, putative [Oryza sativa Japonic... 106 4e-21 ref|XP_004967899.1| PREDICTED: putative pentatricopeptide repeat... 105 6e-21 ref|XP_004984117.1| PREDICTED: pentatricopeptide repeat-containi... 104 1e-20 ref|XP_006651472.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-20 gb|EMJ20419.1| hypothetical protein PRUPE_ppa017678mg, partial [... 103 2e-20 ref|XP_006599001.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-20 ref|XP_004485987.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-20 ref|XP_003624481.1| Pentatricopeptide repeat-containing protein ... 103 2e-20 ref|XP_003553033.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-20 gb|ADE76509.1| unknown [Picea sitchensis] 103 2e-20 gb|EMJ16478.1| hypothetical protein PRUPE_ppa004841mg [Prunus pe... 103 3e-20 gb|AEX11736.1| hypothetical protein 0_16763_01 [Pinus taeda] 103 3e-20 gb|ESW28513.1| hypothetical protein PHAVU_003G292800g [Phaseolus... 102 4e-20 ref|XP_004505212.1| PREDICTED: pentatricopeptide repeat-containi... 102 4e-20 ref|XP_004505209.1| PREDICTED: pentatricopeptide repeat-containi... 102 4e-20 ref|XP_004296063.1| PREDICTED: pentatricopeptide repeat-containi... 102 4e-20 ref|XP_004137278.1| PREDICTED: pentatricopeptide repeat-containi... 102 4e-20 tpg|DAA46104.1| TPA: hypothetical protein ZEAMMB73_772392 [Zea m... 102 4e-20 >ref|XP_002275581.2| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Vitis vinifera] Length = 735 Score = 108 bits (269), Expect = 9e-22 Identities = 47/58 (81%), Positives = 50/58 (86%) Frame = +2 Query: 2 INTAPRTPIQIIKNLRVCGDCHAAIKLIAKLVDREIVVRDSNRFHHFRDGFCSCGDYW 175 +NT P T I IIKNLRVCGDCH AIK I+K+VDREIVVRDS RFHHFRDG CSCGDYW Sbjct: 678 MNTVPGTTIHIIKNLRVCGDCHTAIKFISKIVDREIVVRDSKRFHHFRDGLCSCGDYW 735 >emb|CBI21289.3| unnamed protein product [Vitis vinifera] Length = 581 Score = 108 bits (269), Expect = 9e-22 Identities = 47/58 (81%), Positives = 50/58 (86%) Frame = +2 Query: 2 INTAPRTPIQIIKNLRVCGDCHAAIKLIAKLVDREIVVRDSNRFHHFRDGFCSCGDYW 175 +NT P T I IIKNLRVCGDCH AIK I+K+VDREIVVRDS RFHHFRDG CSCGDYW Sbjct: 524 MNTVPGTTIHIIKNLRVCGDCHTAIKFISKIVDREIVVRDSKRFHHFRDGLCSCGDYW 581 >gb|ABF96424.1| pentatricopeptide, putative [Oryza sativa Japonica Group] gi|125586550|gb|EAZ27214.1| hypothetical protein OsJ_11153 [Oryza sativa Japonica Group] Length = 748 Score = 106 bits (264), Expect = 4e-21 Identities = 43/58 (74%), Positives = 51/58 (87%) Frame = +2 Query: 2 INTAPRTPIQIIKNLRVCGDCHAAIKLIAKLVDREIVVRDSNRFHHFRDGFCSCGDYW 175 INT PRTP+ I KNLRVCGDCH A K I+K+ +REI+VRDSNRFHHF+DG+CSCGD+W Sbjct: 691 INTPPRTPLHIYKNLRVCGDCHNATKYISKITEREIIVRDSNRFHHFKDGYCSCGDFW 748 >ref|XP_004967899.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510-like [Setaria italica] Length = 615 Score = 105 bits (262), Expect = 6e-21 Identities = 43/58 (74%), Positives = 52/58 (89%) Frame = +2 Query: 2 INTAPRTPIQIIKNLRVCGDCHAAIKLIAKLVDREIVVRDSNRFHHFRDGFCSCGDYW 175 INT PRTPI+++KNL C DCH+AIK+I+K+VDREI+VRDS RFHHF+DG CSCGDYW Sbjct: 558 INTPPRTPIRVMKNLSACLDCHSAIKMISKIVDREIIVRDSKRFHHFKDGICSCGDYW 615 >ref|XP_004984117.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Setaria italica] Length = 774 Score = 104 bits (260), Expect = 1e-20 Identities = 43/58 (74%), Positives = 50/58 (86%) Frame = +2 Query: 2 INTAPRTPIQIIKNLRVCGDCHAAIKLIAKLVDREIVVRDSNRFHHFRDGFCSCGDYW 175 INT PRTP+ I KNLRVCGDCH A K I+K+ +REI+VRDSNRFHHF+DG CSCGD+W Sbjct: 717 INTPPRTPLHIYKNLRVCGDCHNATKYISKITEREIIVRDSNRFHHFKDGHCSCGDFW 774 >ref|XP_006651472.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Oryza brachyantha] Length = 749 Score = 103 bits (258), Expect = 2e-20 Identities = 42/58 (72%), Positives = 50/58 (86%) Frame = +2 Query: 2 INTAPRTPIQIIKNLRVCGDCHAAIKLIAKLVDREIVVRDSNRFHHFRDGFCSCGDYW 175 INT P TP+ I KNLRVCGDCH A K I+K+ +REI+VRDSNRFHHF+DG+CSCGD+W Sbjct: 692 INTPPGTPLHIYKNLRVCGDCHNATKFISKITEREIIVRDSNRFHHFKDGYCSCGDFW 749 >gb|EMJ20419.1| hypothetical protein PRUPE_ppa017678mg, partial [Prunus persica] Length = 640 Score = 103 bits (258), Expect = 2e-20 Identities = 43/58 (74%), Positives = 51/58 (87%) Frame = +2 Query: 2 INTAPRTPIQIIKNLRVCGDCHAAIKLIAKLVDREIVVRDSNRFHHFRDGFCSCGDYW 175 +NT P T I+I KNLRVCGDCH AIKLI+K+ +REIV+RD+NRFHHF+DG CSCGDYW Sbjct: 583 LNTDPGTAIRITKNLRVCGDCHIAIKLISKIAEREIVIRDTNRFHHFKDGMCSCGDYW 640 >ref|XP_006599001.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Glycine max] Length = 653 Score = 103 bits (257), Expect = 2e-20 Identities = 44/58 (75%), Positives = 52/58 (89%) Frame = +2 Query: 2 INTAPRTPIQIIKNLRVCGDCHAAIKLIAKLVDREIVVRDSNRFHHFRDGFCSCGDYW 175 +N+ P + IQIIKNLR+CGDCH+AIKLI+K V+REIVVRDS RFHHF+DG CSCGDYW Sbjct: 596 MNSVPGSIIQIIKNLRICGDCHSAIKLISKAVNREIVVRDSKRFHHFKDGLCSCGDYW 653 >ref|XP_004485987.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cicer arietinum] Length = 610 Score = 103 bits (257), Expect = 2e-20 Identities = 43/58 (74%), Positives = 51/58 (87%) Frame = +2 Query: 2 INTAPRTPIQIIKNLRVCGDCHAAIKLIAKLVDREIVVRDSNRFHHFRDGFCSCGDYW 175 +NTAP TPI+++KNLRVC DCH AIKLI+K+ DREIV+RD +RFHHFRDG CSC DYW Sbjct: 553 LNTAPGTPIRVMKNLRVCADCHMAIKLISKVYDREIVIRDRSRFHHFRDGLCSCKDYW 610 >ref|XP_003624481.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|87240699|gb|ABD32557.1| Tetratricopeptide-like helical [Medicago truncatula] gi|355499496|gb|AES80699.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 672 Score = 103 bits (257), Expect = 2e-20 Identities = 43/58 (74%), Positives = 52/58 (89%) Frame = +2 Query: 2 INTAPRTPIQIIKNLRVCGDCHAAIKLIAKLVDREIVVRDSNRFHHFRDGFCSCGDYW 175 +N+ P + IQIIKNLR+CGDCH AIKLI+K+V+REIV+RDS RFHHF+DG CSCGDYW Sbjct: 615 MNSVPGSVIQIIKNLRICGDCHFAIKLISKIVNREIVIRDSKRFHHFKDGLCSCGDYW 672 >ref|XP_003553033.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X1 [Glycine max] gi|571544149|ref|XP_006602168.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X2 [Glycine max] gi|571544153|ref|XP_006602169.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X3 [Glycine max] gi|571544157|ref|XP_006602170.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X4 [Glycine max] gi|571544163|ref|XP_006602171.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X5 [Glycine max] Length = 824 Score = 103 bits (257), Expect = 2e-20 Identities = 42/58 (72%), Positives = 51/58 (87%) Frame = +2 Query: 2 INTAPRTPIQIIKNLRVCGDCHAAIKLIAKLVDREIVVRDSNRFHHFRDGFCSCGDYW 175 I+T P++PI+I KNLRVCGDCH A K I+K+ +REI+VRDSNRFHHF+DG CSCGDYW Sbjct: 767 ISTPPKSPIRIFKNLRVCGDCHNATKYISKITEREIIVRDSNRFHHFKDGICSCGDYW 824 >gb|ADE76509.1| unknown [Picea sitchensis] Length = 246 Score = 103 bits (257), Expect = 2e-20 Identities = 41/58 (70%), Positives = 51/58 (87%) Frame = +2 Query: 2 INTAPRTPIQIIKNLRVCGDCHAAIKLIAKLVDREIVVRDSNRFHHFRDGFCSCGDYW 175 I+T P P++IIKNLRVCGDCH A K I+K+V+REI++RD+NRFHHF+DG CSCGDYW Sbjct: 189 ISTLPGLPVRIIKNLRVCGDCHTATKFISKIVEREIIIRDANRFHHFKDGLCSCGDYW 246 >gb|EMJ16478.1| hypothetical protein PRUPE_ppa004841mg [Prunus persica] Length = 489 Score = 103 bits (256), Expect = 3e-20 Identities = 44/58 (75%), Positives = 50/58 (86%) Frame = +2 Query: 2 INTAPRTPIQIIKNLRVCGDCHAAIKLIAKLVDREIVVRDSNRFHHFRDGFCSCGDYW 175 +N+ P T IQIIKNLRVC DCH IKL++K+V+REIVVRDS RFHHFRDG CSCGDYW Sbjct: 432 MNSVPGTTIQIIKNLRVCADCHTVIKLLSKVVNREIVVRDSKRFHHFRDGLCSCGDYW 489 >gb|AEX11736.1| hypothetical protein 0_16763_01 [Pinus taeda] Length = 119 Score = 103 bits (256), Expect = 3e-20 Identities = 41/58 (70%), Positives = 52/58 (89%) Frame = +2 Query: 2 INTAPRTPIQIIKNLRVCGDCHAAIKLIAKLVDREIVVRDSNRFHHFRDGFCSCGDYW 175 +NT+P TP++IIKNLRVCGDCH+A+K I+ + +REIV+RD+NRFH FRDG CSCGDYW Sbjct: 62 LNTSPETPLRIIKNLRVCGDCHSAMKYISNIAEREIVMRDANRFHRFRDGLCSCGDYW 119 >gb|ESW28513.1| hypothetical protein PHAVU_003G292800g [Phaseolus vulgaris] Length = 571 Score = 102 bits (255), Expect = 4e-20 Identities = 41/58 (70%), Positives = 53/58 (91%) Frame = +2 Query: 2 INTAPRTPIQIIKNLRVCGDCHAAIKLIAKLVDREIVVRDSNRFHHFRDGFCSCGDYW 175 I+T PRTP++IIKNLRVCGDCH AIK+++++V RE++VRD+ RFHHF+DG CSCGDYW Sbjct: 514 ISTPPRTPLRIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 571 >ref|XP_004505212.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Cicer arietinum] Length = 567 Score = 102 bits (255), Expect = 4e-20 Identities = 41/58 (70%), Positives = 53/58 (91%) Frame = +2 Query: 2 INTAPRTPIQIIKNLRVCGDCHAAIKLIAKLVDREIVVRDSNRFHHFRDGFCSCGDYW 175 I+T PRTP++IIKNLRVCGDCH AIK+++++V RE++VRD+ RFHHF+DG CSCGDYW Sbjct: 510 ISTPPRTPLRIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 567 >ref|XP_004505209.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Cicer arietinum] Length = 567 Score = 102 bits (255), Expect = 4e-20 Identities = 41/58 (70%), Positives = 53/58 (91%) Frame = +2 Query: 2 INTAPRTPIQIIKNLRVCGDCHAAIKLIAKLVDREIVVRDSNRFHHFRDGFCSCGDYW 175 I+T PRTP++IIKNLRVCGDCH AIK+++++V RE++VRD+ RFHHF+DG CSCGDYW Sbjct: 510 ISTPPRTPLRIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 567 >ref|XP_004296063.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Fragaria vesca subsp. vesca] Length = 867 Score = 102 bits (255), Expect = 4e-20 Identities = 42/58 (72%), Positives = 50/58 (86%) Frame = +2 Query: 2 INTAPRTPIQIIKNLRVCGDCHAAIKLIAKLVDREIVVRDSNRFHHFRDGFCSCGDYW 175 I+T P+TPI+I KNLRVCGDCH KLI+ + +REI+VRDSNRFHHF+DG CSCGDYW Sbjct: 810 ISTPPKTPIRIFKNLRVCGDCHTVTKLISVITEREIIVRDSNRFHHFKDGTCSCGDYW 867 >ref|XP_004137278.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Cucumis sativus] gi|449476583|ref|XP_004154777.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Cucumis sativus] Length = 816 Score = 102 bits (255), Expect = 4e-20 Identities = 42/58 (72%), Positives = 50/58 (86%) Frame = +2 Query: 2 INTAPRTPIQIIKNLRVCGDCHAAIKLIAKLVDREIVVRDSNRFHHFRDGFCSCGDYW 175 I+T P+T +QI KNLRVCGDCH A K I+K+ +REI+VRDSNRFHHF+DG CSCGDYW Sbjct: 759 ISTPPKTTLQIFKNLRVCGDCHNATKFISKITEREIIVRDSNRFHHFKDGVCSCGDYW 816 >tpg|DAA46104.1| TPA: hypothetical protein ZEAMMB73_772392 [Zea mays] Length = 677 Score = 102 bits (255), Expect = 4e-20 Identities = 44/58 (75%), Positives = 51/58 (87%) Frame = +2 Query: 2 INTAPRTPIQIIKNLRVCGDCHAAIKLIAKLVDREIVVRDSNRFHHFRDGFCSCGDYW 175 +NT+P T + IIKNLRVCGDCH AIK I+K+VDREIVVRD+ RFHHF+DG CSCGDYW Sbjct: 620 LNTSPGTRLVIIKNLRVCGDCHDAIKYISKIVDREIVVRDAKRFHHFKDGACSCGDYW 677