BLASTX nr result
ID: Stemona21_contig00032504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00032504 (436 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ03867.1| hypothetical protein PRUPE_ppa012443mg [Prunus pe... 62 1e-07 gb|EMJ01773.1| hypothetical protein PRUPE_ppa011851mg [Prunus pe... 62 1e-07 ref|XP_004287857.1| PREDICTED: 54S ribosomal protein L12, mitoch... 59 5e-07 ref|XP_006338377.1| PREDICTED: 54S ribosomal protein L12, mitoch... 59 7e-07 ref|XP_004232170.1| PREDICTED: 50S ribosomal protein L7/L12-like... 59 7e-07 ref|XP_004149984.1| PREDICTED: 54S ribosomal protein L12, mitoch... 57 2e-06 gb|EXC24880.1| 54S ribosomal protein L12 [Morus notabilis] 57 3e-06 gb|EPS59599.1| hypothetical protein M569_15206, partial [Genlise... 57 3e-06 ref|XP_002310275.2| hypothetical protein POPTR_0007s13440g [Popu... 56 4e-06 ref|XP_002275239.1| PREDICTED: 60 ribosomal protein L12, mitocho... 56 4e-06 gb|EOX90970.1| 50S ribosomal protein L7/L12, putative [Theobroma... 56 6e-06 ref|XP_006838677.1| hypothetical protein AMTR_s00002p00244430 [A... 55 7e-06 >gb|EMJ03867.1| hypothetical protein PRUPE_ppa012443mg [Prunus persica] Length = 169 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -1 Query: 190 IADEIAGLTLLEVADLSEILRTRLGVAEMPAMALMTPGM 74 IADEI+GLTLLEV+DL+E+LR +LG+ EMP MA+M PGM Sbjct: 60 IADEISGLTLLEVSDLTEVLREKLGIKEMPVMAMMMPGM 98 >gb|EMJ01773.1| hypothetical protein PRUPE_ppa011851mg [Prunus persica] Length = 193 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -1 Query: 190 IADEIAGLTLLEVADLSEILRTRLGVAEMPAMALMTPGM 74 IADEI+GLTLLEV+DL+E+LR +LG+ EMP MA+M PGM Sbjct: 61 IADEISGLTLLEVSDLTEVLREKLGIKEMPVMAMMMPGM 99 >ref|XP_004287857.1| PREDICTED: 54S ribosomal protein L12, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 188 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = -1 Query: 190 IADEIAGLTLLEVADLSEILRTRLGVAEMPAMALMTPGM 74 IADE++GLTLLE++DL+E+LR +LG+ EMP M +M PGM Sbjct: 56 IADEVSGLTLLEISDLTEVLREKLGIKEMPTMVMMMPGM 94 >ref|XP_006338377.1| PREDICTED: 54S ribosomal protein L12, mitochondrial-like [Solanum tuberosum] Length = 207 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = -1 Query: 190 IADEIAGLTLLEVADLSEILRTRLGVAEMPAMALMTPGM 74 I DEI+GLTLLEV+DL E+LR ++G+ EMP MA+M PGM Sbjct: 74 IVDEISGLTLLEVSDLGEVLRKKMGIEEMPVMAMMMPGM 112 >ref|XP_004232170.1| PREDICTED: 50S ribosomal protein L7/L12-like [Solanum lycopersicum] Length = 207 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = -1 Query: 190 IADEIAGLTLLEVADLSEILRTRLGVAEMPAMALMTPGM 74 I DEI+GLTLLEV+DL E+LR ++G+ EMP MA+M PGM Sbjct: 74 IVDEISGLTLLEVSDLGEVLRKKMGIEEMPVMAMMMPGM 112 >ref|XP_004149984.1| PREDICTED: 54S ribosomal protein L12, mitochondrial-like [Cucumis sativus] gi|449491404|ref|XP_004158886.1| PREDICTED: 54S ribosomal protein L12, mitochondrial-like isoform 1 [Cucumis sativus] gi|449491408|ref|XP_004158887.1| PREDICTED: 54S ribosomal protein L12, mitochondrial-like isoform 2 [Cucumis sativus] Length = 202 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -1 Query: 190 IADEIAGLTLLEVADLSEILRTRLGVAEMPAMALMTPGM 74 I DEI+GLTLLEVADL+E+LR +L V EMP M +M PGM Sbjct: 69 IVDEISGLTLLEVADLTEVLREKLDVKEMPVMTMMMPGM 107 >gb|EXC24880.1| 54S ribosomal protein L12 [Morus notabilis] Length = 190 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -1 Query: 190 IADEIAGLTLLEVADLSEILRTRLGVAEMPAMALMTPGM 74 IADEI+GLTLLEV DL+E+LR +L V EMP M +M PGM Sbjct: 53 IADEISGLTLLEVGDLTEVLREKLDVKEMPTMVVMMPGM 91 >gb|EPS59599.1| hypothetical protein M569_15206, partial [Genlisea aurea] Length = 156 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/39 (61%), Positives = 34/39 (87%) Frame = -1 Query: 190 IADEIAGLTLLEVADLSEILRTRLGVAEMPAMALMTPGM 74 I DE++ LTLLE+ADL+E+LR ++G+ EMP+MA+M PGM Sbjct: 24 IVDELSTLTLLEIADLTEVLRKKMGIEEMPSMAMMMPGM 62 >ref|XP_002310275.2| hypothetical protein POPTR_0007s13440g [Populus trichocarpa] gi|550334801|gb|EEE90725.2| hypothetical protein POPTR_0007s13440g [Populus trichocarpa] Length = 192 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/67 (43%), Positives = 40/67 (59%) Frame = -1 Query: 274 FNPPYRSPCSRSHSTXXXXXXXXXXXXAIADEIAGLTLLEVADLSEILRTRLGVAEMPAM 95 F + SP S + +I DE++ LTLLEV+DL+E+LRT+L + EMP M Sbjct: 29 FTRRFTSPSQESTPSPQEPPPSTDRVSSIVDELSKLTLLEVSDLTEVLRTKLEIKEMPVM 88 Query: 94 ALMTPGM 74 A+M PGM Sbjct: 89 AVMMPGM 95 >ref|XP_002275239.1| PREDICTED: 60 ribosomal protein L12, mitochondrial [Vitis vinifera] Length = 189 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = -1 Query: 190 IADEIAGLTLLEVADLSEILRTRLGVAEMPAMALMTPGM 74 I DEI+GLTLLEV+DL+E+LR +L + EMP MA+M PGM Sbjct: 59 IVDEISGLTLLEVSDLTELLRKKLDINEMPVMAVMMPGM 97 >gb|EOX90970.1| 50S ribosomal protein L7/L12, putative [Theobroma cacao] Length = 196 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/70 (44%), Positives = 40/70 (57%) Frame = -1 Query: 283 DHLFNPPYRSPCSRSHSTXXXXXXXXXXXXAIADEIAGLTLLEVADLSEILRTRLGVAEM 104 +H F+ Y +P S I DE++GLTLLEV DL+E+LR +L V EM Sbjct: 35 NHTFSRNYTTPSQESTKQAPSGKVAA-----IVDELSGLTLLEVMDLTEVLRQKLDVKEM 89 Query: 103 PAMALMTPGM 74 P MA+M PGM Sbjct: 90 PIMAVMMPGM 99 >ref|XP_006838677.1| hypothetical protein AMTR_s00002p00244430 [Amborella trichopoda] gi|548841183|gb|ERN01246.1| hypothetical protein AMTR_s00002p00244430 [Amborella trichopoda] Length = 217 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/65 (43%), Positives = 38/65 (58%) Frame = -1 Query: 268 PPYRSPCSRSHSTXXXXXXXXXXXXAIADEIAGLTLLEVADLSEILRTRLGVAEMPAMAL 89 P S C+ SH I ++I+GLTL+EVADL+E+LR R ++EMP M + Sbjct: 60 PNPNSYCNLSHRHYCSSTQPSARVSEIVNDISGLTLMEVADLAEVLRQRFDISEMPIMTV 119 Query: 88 MTPGM 74 M PGM Sbjct: 120 MMPGM 124