BLASTX nr result
ID: Stemona21_contig00031070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00031070 (384 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510609.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 >ref|XP_002510609.1| conserved hypothetical protein [Ricinus communis] gi|223551310|gb|EEF52796.1| conserved hypothetical protein [Ricinus communis] Length = 406 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/66 (40%), Positives = 40/66 (60%) Frame = -3 Query: 322 HSPSGGEILHAPIPESEVYSFRCFASSQGWLLMTDRLARVFLFDPLSNSRVDLPSRAYLP 143 ++PS G+ H +PE+ RC SS GWL+M + +FL +PL+ SR++LPS + P Sbjct: 68 YNPSDGKTYHLELPET--VDKRCCGSSHGWLVMVEDTPSIFLLNPLTKSRIELPSLSTFP 125 Query: 142 NPDTPV 125 N T V Sbjct: 126 NFPTEV 131