BLASTX nr result
ID: Stemona21_contig00030246
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00030246 (314 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB42558.1| DNA repair protein recA-1-like protein [Morus not... 85 9e-15 ref|XP_003562020.1| PREDICTED: DNA repair protein recA homolog 1... 84 3e-14 ref|XP_003562019.1| PREDICTED: DNA repair protein recA homolog 1... 84 3e-14 ref|XP_003562018.1| PREDICTED: DNA repair protein recA homolog 1... 84 3e-14 ref|XP_003546633.1| PREDICTED: DNA repair protein recA homolog 1... 83 3e-14 gb|ESW05313.1| hypothetical protein PHAVU_011G169700g [Phaseolus... 83 4e-14 emb|CBI21810.3| unnamed protein product [Vitis vinifera] 82 7e-14 ref|XP_002271727.1| PREDICTED: DNA repair protein recA homolog 1... 82 7e-14 ref|XP_006651624.1| PREDICTED: DNA repair protein recA homolog 1... 81 1e-13 gb|EMS45921.1| DNA repair protein recA-like protein 1, chloropla... 81 1e-13 dbj|BAJ98339.1| predicted protein [Hordeum vulgare subsp. vulgare] 81 1e-13 gb|ACN27072.1| unknown [Zea mays] gi|414871796|tpg|DAA50353.1| T... 81 1e-13 ref|NP_001148809.1| protein recA [Zea mays] gi|195622282|gb|ACG3... 81 1e-13 ref|NP_001050738.1| Os03g0639700 [Oryza sativa Japonica Group] g... 81 1e-13 ref|XP_004982347.1| PREDICTED: DNA repair protein recA homolog 1... 81 2e-13 ref|XP_002466766.1| hypothetical protein SORBIDRAFT_01g013810 [S... 81 2e-13 gb|EMJ16727.1| hypothetical protein PRUPE_ppa007080mg [Prunus pe... 80 2e-13 ref|XP_004151803.1| PREDICTED: DNA repair protein recA homolog 1... 79 5e-13 ref|XP_004151021.1| PREDICTED: DNA repair protein recA homolog 1... 79 5e-13 ref|XP_006836393.1| hypothetical protein AMTR_s00092p00136000 [A... 78 1e-12 >gb|EXB42558.1| DNA repair protein recA-1-like protein [Morus notabilis] Length = 438 Score = 85.1 bits (209), Expect = 9e-15 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = -1 Query: 146 CEFDARGNGALSGDTDPRVLDRQKALDAAMNDINNSFGKGSVTRLGSA 3 CEFDA+ NGAL G+ DPR LDRQKAL+AAMNDINNSFGKGSVTRLGSA Sbjct: 57 CEFDAKINGALPGEFDPRFLDRQKALEAAMNDINNSFGKGSVTRLGSA 104 >ref|XP_003562020.1| PREDICTED: DNA repair protein recA homolog 1, chloroplastic-like isoform 3 [Brachypodium distachyon] Length = 335 Score = 83.6 bits (205), Expect = 3e-14 Identities = 42/49 (85%), Positives = 45/49 (91%), Gaps = 1/49 (2%) Frame = -1 Query: 146 CEFDAR-GNGALSGDTDPRVLDRQKALDAAMNDINNSFGKGSVTRLGSA 3 CEF A GNGALSG+ DPR++DRQKALDAAMNDINNSFGKGSVTRLGSA Sbjct: 41 CEFVASVGNGALSGEDDPRLIDRQKALDAAMNDINNSFGKGSVTRLGSA 89 >ref|XP_003562019.1| PREDICTED: DNA repair protein recA homolog 1, chloroplastic-like isoform 2 [Brachypodium distachyon] Length = 430 Score = 83.6 bits (205), Expect = 3e-14 Identities = 42/49 (85%), Positives = 45/49 (91%), Gaps = 1/49 (2%) Frame = -1 Query: 146 CEFDAR-GNGALSGDTDPRVLDRQKALDAAMNDINNSFGKGSVTRLGSA 3 CEF A GNGALSG+ DPR++DRQKALDAAMNDINNSFGKGSVTRLGSA Sbjct: 41 CEFVASVGNGALSGEDDPRLIDRQKALDAAMNDINNSFGKGSVTRLGSA 89 >ref|XP_003562018.1| PREDICTED: DNA repair protein recA homolog 1, chloroplastic-like isoform 1 [Brachypodium distachyon] Length = 412 Score = 83.6 bits (205), Expect = 3e-14 Identities = 42/49 (85%), Positives = 45/49 (91%), Gaps = 1/49 (2%) Frame = -1 Query: 146 CEFDAR-GNGALSGDTDPRVLDRQKALDAAMNDINNSFGKGSVTRLGSA 3 CEF A GNGALSG+ DPR++DRQKALDAAMNDINNSFGKGSVTRLGSA Sbjct: 41 CEFVASVGNGALSGEDDPRLIDRQKALDAAMNDINNSFGKGSVTRLGSA 89 >ref|XP_003546633.1| PREDICTED: DNA repair protein recA homolog 1, chloroplastic-like [Glycine max] Length = 414 Score = 83.2 bits (204), Expect = 3e-14 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = -1 Query: 146 CEFDARGNGALSGDTDPRVLDRQKALDAAMNDINNSFGKGSVTRLGSA 3 CE + R NGALSGD DPR +DRQKAL+AAMNDINN+FGKGSVTRLGSA Sbjct: 43 CELEGRPNGALSGDFDPRFIDRQKALEAAMNDINNNFGKGSVTRLGSA 90 >gb|ESW05313.1| hypothetical protein PHAVU_011G169700g [Phaseolus vulgaris] Length = 415 Score = 82.8 bits (203), Expect = 4e-14 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 4/67 (5%) Frame = -1 Query: 191 FPLPIS----PXXXXXXXRCEFDARGNGALSGDTDPRVLDRQKALDAAMNDINNSFGKGS 24 FPLP+ +CE + R NGALSGD DPR +DRQKAL+AAMNDIN+SFGKGS Sbjct: 24 FPLPLRFRAVTAFKHANIQCELEGRPNGALSGDFDPRFIDRQKALEAAMNDINSSFGKGS 83 Query: 23 VTRLGSA 3 VTRLGSA Sbjct: 84 VTRLGSA 90 >emb|CBI21810.3| unnamed protein product [Vitis vinifera] Length = 384 Score = 82.0 bits (201), Expect = 7e-14 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = -1 Query: 146 CEFDARGNGALSGDTDPRVLDRQKALDAAMNDINNSFGKGSVTRLGSA 3 CEF+ + NGALS D DPR LDRQKAL+AAMNDIN+SFGKGSVTRLGSA Sbjct: 12 CEFEVKVNGALSSDPDPRFLDRQKALEAAMNDINSSFGKGSVTRLGSA 59 >ref|XP_002271727.1| PREDICTED: DNA repair protein recA homolog 1, chloroplastic-like [Vitis vinifera] Length = 415 Score = 82.0 bits (201), Expect = 7e-14 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = -1 Query: 146 CEFDARGNGALSGDTDPRVLDRQKALDAAMNDINNSFGKGSVTRLGSA 3 CEF+ + NGALS D DPR LDRQKAL+AAMNDIN+SFGKGSVTRLGSA Sbjct: 43 CEFEVKVNGALSSDPDPRFLDRQKALEAAMNDINSSFGKGSVTRLGSA 90 >ref|XP_006651624.1| PREDICTED: DNA repair protein recA homolog 1, chloroplastic-like, partial [Oryza brachyantha] Length = 371 Score = 81.3 bits (199), Expect = 1e-13 Identities = 41/49 (83%), Positives = 45/49 (91%), Gaps = 1/49 (2%) Frame = -1 Query: 146 CEFDARG-NGALSGDTDPRVLDRQKALDAAMNDINNSFGKGSVTRLGSA 3 CEF A G NGALSG+ DPR++DRQKALDAAMNDIN+SFGKGSVTRLGSA Sbjct: 1 CEFVAGGGNGALSGEDDPRLIDRQKALDAAMNDINSSFGKGSVTRLGSA 49 >gb|EMS45921.1| DNA repair protein recA-like protein 1, chloroplastic [Triticum urartu] Length = 377 Score = 81.3 bits (199), Expect = 1e-13 Identities = 41/49 (83%), Positives = 44/49 (89%), Gaps = 1/49 (2%) Frame = -1 Query: 146 CEFDAR-GNGALSGDTDPRVLDRQKALDAAMNDINNSFGKGSVTRLGSA 3 CEF A GNGALSG+ DPR++DRQKALDAAM DINNSFGKGSVTRLGSA Sbjct: 43 CEFVASVGNGALSGEDDPRLIDRQKALDAAMTDINNSFGKGSVTRLGSA 91 >dbj|BAJ98339.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 336 Score = 81.3 bits (199), Expect = 1e-13 Identities = 41/49 (83%), Positives = 44/49 (89%), Gaps = 1/49 (2%) Frame = -1 Query: 146 CEFDAR-GNGALSGDTDPRVLDRQKALDAAMNDINNSFGKGSVTRLGSA 3 CEF A GNGALSG+ DPR++DRQKALDAAM DINNSFGKGSVTRLGSA Sbjct: 42 CEFVASVGNGALSGEDDPRLIDRQKALDAAMTDINNSFGKGSVTRLGSA 90 >gb|ACN27072.1| unknown [Zea mays] gi|414871796|tpg|DAA50353.1| TPA: putative recA DNA recombination family protein [Zea mays] Length = 433 Score = 81.3 bits (199), Expect = 1e-13 Identities = 41/49 (83%), Positives = 44/49 (89%), Gaps = 1/49 (2%) Frame = -1 Query: 146 CEFDARG-NGALSGDTDPRVLDRQKALDAAMNDINNSFGKGSVTRLGSA 3 CEF A G NGALSG+ DPR++DRQK LDAAMNDINNSFGKGSVTRLGSA Sbjct: 44 CEFVAGGGNGALSGEDDPRLVDRQKVLDAAMNDINNSFGKGSVTRLGSA 92 >ref|NP_001148809.1| protein recA [Zea mays] gi|195622282|gb|ACG32971.1| protein recA [Zea mays] gi|238008650|gb|ACR35360.1| unknown [Zea mays] gi|414871794|tpg|DAA50351.1| TPA: putative recA DNA recombination family protein isoform 1 [Zea mays] gi|414871795|tpg|DAA50352.1| TPA: putative recA DNA recombination family protein isoform 2 [Zea mays] Length = 415 Score = 81.3 bits (199), Expect = 1e-13 Identities = 41/49 (83%), Positives = 44/49 (89%), Gaps = 1/49 (2%) Frame = -1 Query: 146 CEFDARG-NGALSGDTDPRVLDRQKALDAAMNDINNSFGKGSVTRLGSA 3 CEF A G NGALSG+ DPR++DRQK LDAAMNDINNSFGKGSVTRLGSA Sbjct: 44 CEFVAGGGNGALSGEDDPRLVDRQKVLDAAMNDINNSFGKGSVTRLGSA 92 >ref|NP_001050738.1| Os03g0639700 [Oryza sativa Japonica Group] gi|108710024|gb|ABF97819.1| DNA repair protein recA, chloroplast precursor, putative, expressed [Oryza sativa Japonica Group] gi|113549209|dbj|BAF12652.1| Os03g0639700 [Oryza sativa Japonica Group] gi|215704578|dbj|BAG94211.1| unnamed protein product [Oryza sativa Japonica Group] Length = 418 Score = 81.3 bits (199), Expect = 1e-13 Identities = 41/49 (83%), Positives = 45/49 (91%), Gaps = 1/49 (2%) Frame = -1 Query: 146 CEFDARG-NGALSGDTDPRVLDRQKALDAAMNDINNSFGKGSVTRLGSA 3 CEF A G NGALSG+ DPR++DRQKALDAAMNDIN+SFGKGSVTRLGSA Sbjct: 48 CEFVAGGGNGALSGEDDPRLIDRQKALDAAMNDINSSFGKGSVTRLGSA 96 >ref|XP_004982347.1| PREDICTED: DNA repair protein recA homolog 1, chloroplastic-like [Setaria italica] Length = 417 Score = 80.9 bits (198), Expect = 2e-13 Identities = 41/49 (83%), Positives = 45/49 (91%), Gaps = 1/49 (2%) Frame = -1 Query: 146 CEFDARG-NGALSGDTDPRVLDRQKALDAAMNDINNSFGKGSVTRLGSA 3 CEF A G NGALSG+ DPR++DRQKALDAAM+DINNSFGKGSVTRLGSA Sbjct: 46 CEFVAGGGNGALSGEDDPRLVDRQKALDAAMSDINNSFGKGSVTRLGSA 94 >ref|XP_002466766.1| hypothetical protein SORBIDRAFT_01g013810 [Sorghum bicolor] gi|241920620|gb|EER93764.1| hypothetical protein SORBIDRAFT_01g013810 [Sorghum bicolor] Length = 415 Score = 80.9 bits (198), Expect = 2e-13 Identities = 41/49 (83%), Positives = 45/49 (91%), Gaps = 1/49 (2%) Frame = -1 Query: 146 CEFDARG-NGALSGDTDPRVLDRQKALDAAMNDINNSFGKGSVTRLGSA 3 CEF A G NGALSG+ DPR++DRQKALDAAMNDIN+SFGKGSVTRLGSA Sbjct: 44 CEFVAGGGNGALSGEDDPRLVDRQKALDAAMNDINSSFGKGSVTRLGSA 92 >gb|EMJ16727.1| hypothetical protein PRUPE_ppa007080mg [Prunus persica] Length = 383 Score = 80.5 bits (197), Expect = 2e-13 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = -1 Query: 146 CEFDARGNGALSGDTDPRVLDRQKALDAAMNDINNSFGKGSVTRLGSA 3 CE A+ NGALS D+DPR +DRQKAL+AAMNDIN+SFGKGSVTRLGSA Sbjct: 11 CELQAKVNGALSADSDPRFIDRQKALEAAMNDINSSFGKGSVTRLGSA 58 >ref|XP_004151803.1| PREDICTED: DNA repair protein recA homolog 1, chloroplastic-like, partial [Cucumis sativus] Length = 125 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = -1 Query: 146 CEFDARGNGALSGDTDPRVLDRQKALDAAMNDINNSFGKGSVTRLGSA 3 CEF+ NGALSGD DPR +DR+KAL+AAMNDIN SFGKGSVTRLGSA Sbjct: 48 CEFEVNLNGALSGDFDPRSVDRKKALEAAMNDINGSFGKGSVTRLGSA 95 >ref|XP_004151021.1| PREDICTED: DNA repair protein recA homolog 1, chloroplastic-like [Cucumis sativus] Length = 417 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = -1 Query: 146 CEFDARGNGALSGDTDPRVLDRQKALDAAMNDINNSFGKGSVTRLGSA 3 CEF+ NGALSGD DPR +DR+KAL+AAMNDIN SFGKGSVTRLGSA Sbjct: 48 CEFEVNLNGALSGDFDPRSVDRKKALEAAMNDINGSFGKGSVTRLGSA 95 >ref|XP_006836393.1| hypothetical protein AMTR_s00092p00136000 [Amborella trichopoda] gi|548838911|gb|ERM99246.1| hypothetical protein AMTR_s00092p00136000 [Amborella trichopoda] Length = 406 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = -1 Query: 146 CEFDARGNGALSGDTDPRVLDRQKALDAAMNDINNSFGKGSVTRLGSA 3 C+ +A+GNGAL D D R +DRQKAL+AAMNDINNSFGKGSVTRLGSA Sbjct: 36 CDAEAKGNGALFSDADSRSVDRQKALEAAMNDINNSFGKGSVTRLGSA 83