BLASTX nr result
ID: Stemona21_contig00029953
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00029953 (298 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_566036.1| protease inhibitor/seed storage/lipid transfer ... 68 1e-09 gb|EXB37087.1| hypothetical protein L484_020878 [Morus notabilis] 67 2e-09 ref|XP_006397698.1| hypothetical protein EUTSA_v10001680mg [Eutr... 67 3e-09 gb|EOX96286.1| Bifunctional inhibitor/lipid-transfer protein/see... 67 3e-09 ref|XP_006295216.1| hypothetical protein CARUB_v10024298mg [Caps... 67 3e-09 gb|AEX33654.1| lipid transfer protein [Uromyces hobsonii] 66 4e-09 ref|XP_006477234.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 65 9e-09 ref|XP_006440349.1| hypothetical protein CICLE_v10022832mg [Citr... 65 9e-09 ref|XP_004298648.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 65 1e-08 gb|EMJ19775.1| hypothetical protein PRUPE_ppa013120mg [Prunus pe... 65 1e-08 ref|XP_002533292.1| 14 kDa proline-rich protein DC2.15 precursor... 65 1e-08 dbj|BAK05563.1| predicted protein [Hordeum vulgare subsp. vulgare] 64 2e-08 emb|CAL07983.1| arachidonic acid-induced DEA1-like protein [Plat... 64 2e-08 ref|XP_003559027.1| PREDICTED: uncharacterized protein LOC100840... 64 3e-08 ref|XP_002533294.1| 14 kDa proline-rich protein DC2.15 precursor... 64 3e-08 ref|XP_002533293.1| 14 kDa proline-rich protein DC2.15 precursor... 64 3e-08 ref|XP_002304421.2| hypothetical protein POPTR_0003s11070g, part... 63 4e-08 ref|XP_002271461.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 63 4e-08 ref|XP_002326451.1| predicted protein [Populus trichocarpa] gi|5... 63 4e-08 emb|CBI31906.3| unnamed protein product [Vitis vinifera] 63 4e-08 >ref|NP_566036.1| protease inhibitor/seed storage/lipid transfer protein (LTP) family protein [Arabidopsis thaliana] gi|15983388|gb|AAL11562.1|AF424568_1 At2g45180/T14P1.1 [Arabidopsis thaliana] gi|2583134|gb|AAB82643.1| expressed protein [Arabidopsis thaliana] gi|21553826|gb|AAM62919.1| unknown [Arabidopsis thaliana] gi|56236110|gb|AAV84511.1| At2g45180 [Arabidopsis thaliana] gi|110739938|dbj|BAF01874.1| putative proline-rich protein [Arabidopsis thaliana] gi|110740479|dbj|BAF02133.1| putative proline-rich protein [Arabidopsis thaliana] gi|110742750|dbj|BAE99283.1| putative proline-rich protein [Arabidopsis thaliana] gi|115311435|gb|ABI93898.1| At2g45180 [Arabidopsis thaliana] gi|330255428|gb|AEC10522.1| protease inhibitor/seed storage/lipid transfer protein (LTP) family protein [Arabidopsis thaliana] Length = 134 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -3 Query: 296 AIKANVLGINLSIPVDLSLLLNYCGKKVPKGFQCS 192 A+KANVLGINL++P+DL+LLLNYCGKKVP GFQCS Sbjct: 100 ALKANVLGINLNVPIDLTLLLNYCGKKVPHGFQCS 134 >gb|EXB37087.1| hypothetical protein L484_020878 [Morus notabilis] Length = 135 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -3 Query: 296 AIKANVLGINLSIPVDLSLLLNYCGKKVPKGFQC 195 AIKANVLGINL+IPV LSLLLNYCGKK PKGFQC Sbjct: 101 AIKANVLGINLNIPVSLSLLLNYCGKKAPKGFQC 134 >ref|XP_006397698.1| hypothetical protein EUTSA_v10001680mg [Eutrema salsugineum] gi|557098771|gb|ESQ39151.1| hypothetical protein EUTSA_v10001680mg [Eutrema salsugineum] Length = 134 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -3 Query: 296 AIKANVLGINLSIPVDLSLLLNYCGKKVPKGFQCS 192 A+KANVLGINL++PVDLSLLLNYCGKK+P GFQC+ Sbjct: 100 ALKANVLGINLNVPVDLSLLLNYCGKKLPYGFQCA 134 >gb|EOX96286.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Theobroma cacao] Length = 139 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -3 Query: 296 AIKANVLGINLSIPVDLSLLLNYCGKKVPKGFQCS 192 AIKAN+LGINL++PV LSLLLNYCGK VPKGFQC+ Sbjct: 105 AIKANILGINLNVPVSLSLLLNYCGKNVPKGFQCA 139 >ref|XP_006295216.1| hypothetical protein CARUB_v10024298mg [Capsella rubella] gi|482563924|gb|EOA28114.1| hypothetical protein CARUB_v10024298mg [Capsella rubella] Length = 134 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -3 Query: 296 AIKANVLGINLSIPVDLSLLLNYCGKKVPKGFQCS 192 A+KANVLGINL++PVDLSLLLNYCGKK+P GFQC+ Sbjct: 100 ALKANVLGINLNVPVDLSLLLNYCGKKLPYGFQCA 134 >gb|AEX33654.1| lipid transfer protein [Uromyces hobsonii] Length = 137 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 296 AIKANVLGINLSIPVDLSLLLNYCGKKVPKGFQC 195 AIKANVLGINL++PV LSLLLNYCGKKVP GFQC Sbjct: 100 AIKANVLGINLNVPVSLSLLLNYCGKKVPTGFQC 133 >ref|XP_006477234.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis] Length = 134 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 296 AIKANVLGINLSIPVDLSLLLNYCGKKVPKGFQCS 192 AIKAN+LGINL++PV LSLLLN+CGKKVP GFQC+ Sbjct: 100 AIKANILGINLNVPVSLSLLLNFCGKKVPSGFQCA 134 >ref|XP_006440349.1| hypothetical protein CICLE_v10022832mg [Citrus clementina] gi|557542611|gb|ESR53589.1| hypothetical protein CICLE_v10022832mg [Citrus clementina] Length = 131 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 296 AIKANVLGINLSIPVDLSLLLNYCGKKVPKGFQCS 192 AIKAN+LGINL++PV LSLLLN+CGKKVP GFQC+ Sbjct: 97 AIKANILGINLNVPVSLSLLLNFCGKKVPSGFQCA 131 >ref|XP_004298648.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria vesca subsp. vesca] Length = 138 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 296 AIKANVLGINLSIPVDLSLLLNYCGKKVPKGFQCS 192 AIKANVLGINL++PV LSLLLNYCGKKVP G++C+ Sbjct: 104 AIKANVLGINLNVPVSLSLLLNYCGKKVPSGYECA 138 >gb|EMJ19775.1| hypothetical protein PRUPE_ppa013120mg [Prunus persica] Length = 139 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 296 AIKANVLGINLSIPVDLSLLLNYCGKKVPKGFQCS 192 AIKANVLGINL++PV LSLLLNYCGK VP GFQC+ Sbjct: 105 AIKANVLGINLNVPVSLSLLLNYCGKSVPTGFQCA 139 >ref|XP_002533292.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus communis] gi|223526876|gb|EEF29086.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus communis] Length = 137 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/34 (82%), Positives = 34/34 (100%) Frame = -3 Query: 293 IKANVLGINLSIPVDLSLLLNYCGKKVPKGFQCS 192 IKA++LGINLS+PVDLSLLLNYCGKKVP+GF+C+ Sbjct: 104 IKASLLGINLSVPVDLSLLLNYCGKKVPEGFKCA 137 >dbj|BAK05563.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 193 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -3 Query: 296 AIKANVLGINLSIPVDLSLLLNYCGKKVPKGFQC 195 A+KAN+LGINL++P+DLSLL+NYCGK VP GFQC Sbjct: 158 ALKANILGINLNVPIDLSLLVNYCGKNVPAGFQC 191 >emb|CAL07983.1| arachidonic acid-induced DEA1-like protein [Platanus x acerifolia] Length = 66 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 296 AIKANVLGINLSIPVDLSLLLNYCGKKVPKGFQC 195 AIKA +LGINL++PV LSLLLNYCGKKVP GFQC Sbjct: 32 AIKAKILGINLNVPVSLSLLLNYCGKKVPNGFQC 65 >ref|XP_003559027.1| PREDICTED: uncharacterized protein LOC100840668 [Brachypodium distachyon] gi|193848563|gb|ACF22748.1| proline-rich protein [Brachypodium distachyon] Length = 186 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/34 (73%), Positives = 33/34 (97%) Frame = -3 Query: 296 AIKANVLGINLSIPVDLSLLLNYCGKKVPKGFQC 195 A++AN+LGINL++P+DLSLL+NYCGK+VP GFQC Sbjct: 152 ALRANILGINLNVPIDLSLLVNYCGKRVPTGFQC 185 >ref|XP_002533294.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus communis] gi|223526878|gb|EEF29088.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus communis] Length = 140 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/34 (79%), Positives = 34/34 (100%) Frame = -3 Query: 296 AIKANVLGINLSIPVDLSLLLNYCGKKVPKGFQC 195 +IKA++LGINL++PVDLSL+LNYCGKKVP+GFQC Sbjct: 106 SIKASLLGINLNLPVDLSLVLNYCGKKVPEGFQC 139 >ref|XP_002533293.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus communis] gi|223526877|gb|EEF29087.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus communis] Length = 136 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/34 (79%), Positives = 34/34 (100%) Frame = -3 Query: 293 IKANVLGINLSIPVDLSLLLNYCGKKVPKGFQCS 192 IKA++LGINL++PVDLSLLLNYCGKKVP+GF+C+ Sbjct: 103 IKASLLGINLNVPVDLSLLLNYCGKKVPEGFKCA 136 >ref|XP_002304421.2| hypothetical protein POPTR_0003s11070g, partial [Populus trichocarpa] gi|550342945|gb|EEE79400.2| hypothetical protein POPTR_0003s11070g, partial [Populus trichocarpa] Length = 120 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 296 AIKANVLGINLSIPVDLSLLLNYCGKKVPKGFQCS 192 AIKAN+LGINL+IP+ LSLLLN CGKKVPK FQCS Sbjct: 86 AIKANILGINLNIPLSLSLLLNVCGKKVPKDFQCS 120 >ref|XP_002271461.1| PREDICTED: 14 kDa proline-rich protein DC2.15 isoform 1 [Vitis vinifera] Length = 132 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 296 AIKANVLGINLSIPVDLSLLLNYCGKKVPKGFQCS 192 AIKANVLGI L++PV LSLLLNYCGKKVP G+QC+ Sbjct: 98 AIKANVLGIKLNVPVSLSLLLNYCGKKVPTGYQCA 132 >ref|XP_002326451.1| predicted protein [Populus trichocarpa] gi|566149250|ref|XP_006369032.1| HyPRP family protein [Populus trichocarpa] gi|550347391|gb|ERP65601.1| HyPRP family protein [Populus trichocarpa] Length = 132 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 296 AIKANVLGINLSIPVDLSLLLNYCGKKVPKGFQCS 192 AIKAN+LGINL+IPV LSLLLN CGKKVPK FQC+ Sbjct: 98 AIKANILGINLNIPVSLSLLLNVCGKKVPKDFQCA 132 >emb|CBI31906.3| unnamed protein product [Vitis vinifera] Length = 113 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 296 AIKANVLGINLSIPVDLSLLLNYCGKKVPKGFQCS 192 AIKANVLGI L++PV LSLLLNYCGKKVP G+QC+ Sbjct: 79 AIKANVLGIKLNVPVSLSLLLNYCGKKVPTGYQCA 113