BLASTX nr result
ID: Stemona21_contig00029712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00029712 (486 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002444700.1| hypothetical protein SORBIDRAFT_07g026250 [S... 77 3e-12 gb|AFW61564.1| hypothetical protein ZEAMMB73_198123 [Zea mays] 75 9e-12 gb|AFW80849.1| putative protein kinase superfamily protein [Zea ... 74 3e-11 ref|XP_004974883.1| PREDICTED: uncharacterized protein LOC101766... 72 8e-11 ref|XP_006659618.1| PREDICTED: uncharacterized protein LOC102699... 68 1e-09 ref|XP_003574821.1| PREDICTED: uncharacterized protein LOC100843... 67 2e-09 tpg|DAA48208.1| TPA: hypothetical protein ZEAMMB73_056365 [Zea m... 64 2e-08 gb|EMT14031.1| hypothetical protein F775_10798 [Aegilops tauschii] 64 3e-08 dbj|BAJ92023.1| predicted protein [Hordeum vulgare subsp. vulgare] 64 3e-08 >ref|XP_002444700.1| hypothetical protein SORBIDRAFT_07g026250 [Sorghum bicolor] gi|241941050|gb|EES14195.1| hypothetical protein SORBIDRAFT_07g026250 [Sorghum bicolor] Length = 892 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/42 (80%), Positives = 35/42 (83%) Frame = +1 Query: 1 AVAPNDEYLCSGGDDQKVVLYHNSRGRTKLNWRLSHPLTEKD 126 AVAPNDEYLC+GG DQKVVLYHN GRT LNWRLSHPL D Sbjct: 851 AVAPNDEYLCTGGSDQKVVLYHNRSGRTHLNWRLSHPLQGND 892 >gb|AFW61564.1| hypothetical protein ZEAMMB73_198123 [Zea mays] Length = 66 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = +1 Query: 1 AVAPNDEYLCSGGDDQKVVLYHNSRGRTKLNWRLSHPLTEKD 126 AVAPND+YLC+GG DQKVVLYHN GRT LNWRLSHPL D Sbjct: 25 AVAPNDKYLCTGGSDQKVVLYHNRSGRTHLNWRLSHPLQGND 66 >gb|AFW80849.1| putative protein kinase superfamily protein [Zea mays] Length = 392 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = +1 Query: 4 VAPNDEYLCSGGDDQKVVLYHNSRGRTKLNWRLSHPLTEKD 126 VAPND+YLC+GG DQKVVLYHN GRT LNWRLSHPL D Sbjct: 352 VAPNDKYLCTGGSDQKVVLYHNRSGRTHLNWRLSHPLQGND 392 >ref|XP_004974883.1| PREDICTED: uncharacterized protein LOC101766015 [Setaria italica] Length = 900 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/42 (76%), Positives = 34/42 (80%) Frame = +1 Query: 1 AVAPNDEYLCSGGDDQKVVLYHNSRGRTKLNWRLSHPLTEKD 126 AVAPNDEY+ +GG DQKVVLYHN GRT LNWRLSHPL D Sbjct: 859 AVAPNDEYISTGGSDQKVVLYHNRSGRTHLNWRLSHPLQGND 900 >ref|XP_006659618.1| PREDICTED: uncharacterized protein LOC102699889 [Oryza brachyantha] Length = 721 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +1 Query: 1 AVAPNDEYLCSGGDDQKVVLYHNSRGRTKLNWRLSHPLTEKD 126 AVAPNDEY+ +GG DQKVVLYHN GR +LNWRL++PL D Sbjct: 680 AVAPNDEYISTGGSDQKVVLYHNKSGRAQLNWRLTYPLPGND 721 >ref|XP_003574821.1| PREDICTED: uncharacterized protein LOC100843686 [Brachypodium distachyon] Length = 910 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +1 Query: 1 AVAPNDEYLCSGGDDQKVVLYHNSRGRTKLNWRLSHPLTEKD 126 AVAPNDEY+ +GG DQKVVLYHN GR LNWRL++PL D Sbjct: 869 AVAPNDEYISTGGSDQKVVLYHNRNGRANLNWRLTYPLPGND 910 >tpg|DAA48208.1| TPA: hypothetical protein ZEAMMB73_056365 [Zea mays] Length = 131 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 4 VAPNDEYLCSGGDDQKVVLYHNSRGRTKLNWRLSHPL 114 VAPND+YLC+ G DQKVVLYH+ GRT LNW LSHPL Sbjct: 91 VAPNDKYLCTRGSDQKVVLYHDRSGRTHLNWCLSHPL 127 >gb|EMT14031.1| hypothetical protein F775_10798 [Aegilops tauschii] Length = 765 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +1 Query: 1 AVAPNDEYLCSGGDDQKVVLYHNSRGRTKLNWRLSHPLTEKD 126 AVAPNDEY+ +GG DQKVVLYHN G LNWRL++PL D Sbjct: 724 AVAPNDEYISTGGSDQKVVLYHNRNGCAHLNWRLTYPLPGTD 765 >dbj|BAJ92023.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 917 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +1 Query: 1 AVAPNDEYLCSGGDDQKVVLYHNSRGRTKLNWRLSHPLTEKD 126 AVAPNDEY+ +GG DQKVVLYHN G LNWRL++PL D Sbjct: 876 AVAPNDEYISTGGSDQKVVLYHNRNGCAHLNWRLTYPLPGTD 917