BLASTX nr result
ID: Stemona21_contig00029588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00029588 (381 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB36783.1| aminopeptidase-like protein [Arabidopsis thalian... 47 8e-06 >emb|CAB36783.1| aminopeptidase-like protein [Arabidopsis thaliana] gi|7270256|emb|CAB80026.1| aminopeptidase-like protein [Arabidopsis thaliana] Length = 873 Score = 47.0 bits (110), Expect(2) = 8e-06 Identities = 21/32 (65%), Positives = 25/32 (78%) Frame = -1 Query: 342 KYFCVPYSLPKLDMVVISDFAARAMKNCRLVT 247 +YF VPY LPK+DM+ I DFAA AM+N LVT Sbjct: 265 RYFAVPYPLPKMDMIAIPDFAAGAMENYGLVT 296 Score = 28.1 bits (61), Expect(2) = 8e-06 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 247 THLLYDENRSSTLGKQEVSYVKHD 176 T LLYDE S+ KQ VSY+ D Sbjct: 300 TALLYDEQHSAASNKQRVSYLATD 323