BLASTX nr result
ID: Stemona21_contig00029523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00029523 (434 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAR86717.1| zinc finger protein [Populus euphratica] 67 2e-09 ref|XP_003588283.1| Cytochrome c biogenesis [Medicago truncatula... 56 4e-06 >gb|AAR86717.1| zinc finger protein [Populus euphratica] Length = 218 Score = 67.4 bits (163), Expect = 2e-09 Identities = 40/67 (59%), Positives = 44/67 (65%), Gaps = 1/67 (1%) Frame = -2 Query: 301 TLGAGHIERDESTGNANW*SGIKHP**YAKRGCDD-IYVRIAPRD*IPHPTNLYFYQGTR 125 T A H ER ES GNA+W SG+KHP Y KRG DD IYVR APR P T + F QGT Sbjct: 14 TPSADHTERHESAGNASWRSGVKHPMRYEKRGRDDIIYVRTAPRGVDPASTQV-FDQGTG 72 Query: 124 EFLLPLA 104 +F LPLA Sbjct: 73 KFPLPLA 79 >ref|XP_003588283.1| Cytochrome c biogenesis [Medicago truncatula] gi|355477331|gb|AES58534.1| Cytochrome c biogenesis [Medicago truncatula] Length = 860 Score = 56.2 bits (134), Expect = 4e-06 Identities = 34/48 (70%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = -3 Query: 300 HLVLATLREMKAQEMPIGEVALSIRNDTQREVVMI-STSVLLLVIRSR 160 H VL TLRE KAQ MP+GEVALSI + T+REVVMI STSV LL R R Sbjct: 302 HPVLTTLRETKAQVMPVGEVALSIPSGTKREVVMISSTSVPLLPGRER 349