BLASTX nr result
ID: Stemona21_contig00029100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00029100 (718 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004242787.1| PREDICTED: ABC transporter E family member 2... 85 2e-14 ref|XP_006662991.1| PREDICTED: ABC transporter E family member 2... 85 3e-14 ref|XP_006858622.1| hypothetical protein AMTR_s00066p00025940 [A... 85 3e-14 ref|XP_004979432.1| PREDICTED: ABC transporter E family member 2... 85 3e-14 gb|EOY25363.1| RNAse l inhibitor protein 2 isoform 1 [Theobroma ... 85 3e-14 ref|NP_001068062.1| Os11g0546000 [Oryza sativa Japonica Group] g... 85 3e-14 gb|AFW88470.1| hypothetical protein ZEAMMB73_854523 [Zea mays] 85 3e-14 ref|XP_002468219.1| hypothetical protein SORBIDRAFT_01g042020 [S... 85 3e-14 gb|ABR25404.1| ATP binding cassette subfamily e- member 1 [Oryza... 85 3e-14 gb|AFW88469.1| hypothetical protein ZEAMMB73_854523, partial [Ze... 84 5e-14 ref|XP_006366958.1| PREDICTED: ABC transporter E family member 2... 84 6e-14 ref|XP_006359955.1| PREDICTED: ABC transporter E family member 2... 84 6e-14 ref|XP_006413992.1| hypothetical protein EUTSA_v10024707mg [Eutr... 84 6e-14 ref|XP_006286029.1| hypothetical protein CARUB_v10007560mg [Caps... 84 6e-14 gb|AGC70150.1| ABC transporter E family member 2 protein [Cardam... 84 6e-14 gb|AAO32059.1| RNase L inhibitor-like protein [Brassica rapa sub... 84 6e-14 gb|ABR18176.1| unknown [Picea sitchensis] 84 6e-14 dbj|BAD94217.1| RNase L inhibitor-like protein [Arabidopsis thal... 84 6e-14 emb|CAA16710.1| RNase L inhibitor-like protein [Arabidopsis thal... 84 6e-14 ref|NP_193656.2| RNAse l inhibitor protein 2 [Arabidopsis thalia... 84 6e-14 >ref|XP_004242787.1| PREDICTED: ABC transporter E family member 2-like isoform 1 [Solanum lycopersicum] gi|460394394|ref|XP_004242788.1| PREDICTED: ABC transporter E family member 2-like isoform 2 [Solanum lycopersicum] Length = 605 Score = 85.1 bits (209), Expect = 2e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +3 Query: 381 IQHLNITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 503 + HLNITFRRDPTNYRPRINKL+STKDREQKSAGSYYYLDD Sbjct: 565 LSHLNITFRRDPTNYRPRINKLESTKDREQKSAGSYYYLDD 605 >ref|XP_006662991.1| PREDICTED: ABC transporter E family member 2-like [Oryza brachyantha] Length = 604 Score = 84.7 bits (208), Expect = 3e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +3 Query: 381 IQHLNITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 503 + HL+ITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD Sbjct: 564 LSHLDITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 604 >ref|XP_006858622.1| hypothetical protein AMTR_s00066p00025940 [Amborella trichopoda] gi|548862733|gb|ERN20089.1| hypothetical protein AMTR_s00066p00025940 [Amborella trichopoda] Length = 606 Score = 84.7 bits (208), Expect = 3e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +3 Query: 381 IQHLNITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 503 + HL+ITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD Sbjct: 566 LSHLDITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 606 >ref|XP_004979432.1| PREDICTED: ABC transporter E family member 2-like [Setaria italica] Length = 604 Score = 84.7 bits (208), Expect = 3e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +3 Query: 381 IQHLNITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 503 + HL+ITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD Sbjct: 564 LSHLDITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 604 >gb|EOY25363.1| RNAse l inhibitor protein 2 isoform 1 [Theobroma cacao] Length = 605 Score = 84.7 bits (208), Expect = 3e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +3 Query: 381 IQHLNITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 503 + HL+ITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD Sbjct: 565 LSHLDITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 605 >ref|NP_001068062.1| Os11g0546000 [Oryza sativa Japonica Group] gi|77551423|gb|ABA94220.1| ATP-binding cassette sub-family E member 1, putative, expressed [Oryza sativa Japonica Group] gi|113645284|dbj|BAF28425.1| Os11g0546000 [Oryza sativa Japonica Group] Length = 604 Score = 84.7 bits (208), Expect = 3e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +3 Query: 381 IQHLNITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 503 + HL+ITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD Sbjct: 564 LSHLDITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 604 >gb|AFW88470.1| hypothetical protein ZEAMMB73_854523 [Zea mays] Length = 604 Score = 84.7 bits (208), Expect = 3e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +3 Query: 381 IQHLNITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 503 + HL+ITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD Sbjct: 564 LSHLDITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 604 >ref|XP_002468219.1| hypothetical protein SORBIDRAFT_01g042020 [Sorghum bicolor] gi|241922073|gb|EER95217.1| hypothetical protein SORBIDRAFT_01g042020 [Sorghum bicolor] Length = 604 Score = 84.7 bits (208), Expect = 3e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +3 Query: 381 IQHLNITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 503 + HL+ITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD Sbjct: 564 LSHLDITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 604 >gb|ABR25404.1| ATP binding cassette subfamily e- member 1 [Oryza sativa Indica Group] Length = 108 Score = 84.7 bits (208), Expect = 3e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +3 Query: 381 IQHLNITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 503 + HL+ITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD Sbjct: 68 LSHLDITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 108 >gb|AFW88469.1| hypothetical protein ZEAMMB73_854523, partial [Zea mays] Length = 39 Score = 84.0 bits (206), Expect = 5e-14 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 387 HLNITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 503 HL+ITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD Sbjct: 1 HLDITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 39 >ref|XP_006366958.1| PREDICTED: ABC transporter E family member 2-like isoform X1 [Solanum tuberosum] gi|565403008|ref|XP_006366959.1| PREDICTED: ABC transporter E family member 2-like isoform X2 [Solanum tuberosum] gi|565403010|ref|XP_006366960.1| PREDICTED: ABC transporter E family member 2-like isoform X3 [Solanum tuberosum] Length = 605 Score = 83.6 bits (205), Expect = 6e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +3 Query: 381 IQHLNITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 503 + HLNITFRRDPTN+RPRINKL+STKDREQKSAGSYYYLDD Sbjct: 565 LSHLNITFRRDPTNFRPRINKLESTKDREQKSAGSYYYLDD 605 >ref|XP_006359955.1| PREDICTED: ABC transporter E family member 2-like [Solanum tuberosum] Length = 606 Score = 83.6 bits (205), Expect = 6e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +3 Query: 381 IQHLNITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 503 + HLNITFRRDPTN+RPRINKL+STKDREQKSAGSYYYLDD Sbjct: 566 LSHLNITFRRDPTNFRPRINKLESTKDREQKSAGSYYYLDD 606 >ref|XP_006413992.1| hypothetical protein EUTSA_v10024707mg [Eutrema salsugineum] gi|557115162|gb|ESQ55445.1| hypothetical protein EUTSA_v10024707mg [Eutrema salsugineum] Length = 605 Score = 83.6 bits (205), Expect = 6e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +3 Query: 381 IQHLNITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 503 + HLNITFRRDPTN+RPRINKL+STKDREQKSAGSYYYLDD Sbjct: 565 LSHLNITFRRDPTNFRPRINKLESTKDREQKSAGSYYYLDD 605 >ref|XP_006286029.1| hypothetical protein CARUB_v10007560mg [Capsella rubella] gi|482554734|gb|EOA18927.1| hypothetical protein CARUB_v10007560mg [Capsella rubella] Length = 605 Score = 83.6 bits (205), Expect = 6e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +3 Query: 381 IQHLNITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 503 + HLNITFRRDPTN+RPRINKL+STKDREQKSAGSYYYLDD Sbjct: 565 LSHLNITFRRDPTNFRPRINKLESTKDREQKSAGSYYYLDD 605 >gb|AGC70150.1| ABC transporter E family member 2 protein [Cardamine hirsuta] Length = 605 Score = 83.6 bits (205), Expect = 6e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +3 Query: 381 IQHLNITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 503 + HLNITFRRDPTN+RPRINKL+STKDREQKSAGSYYYLDD Sbjct: 565 LSHLNITFRRDPTNFRPRINKLESTKDREQKSAGSYYYLDD 605 >gb|AAO32059.1| RNase L inhibitor-like protein [Brassica rapa subsp. pekinensis] Length = 176 Score = 83.6 bits (205), Expect = 6e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +3 Query: 381 IQHLNITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 503 + HLNITFRRDPTN+RPRINKL+STKDREQKSAGSYYYLDD Sbjct: 136 LSHLNITFRRDPTNFRPRINKLESTKDREQKSAGSYYYLDD 176 >gb|ABR18176.1| unknown [Picea sitchensis] Length = 605 Score = 83.6 bits (205), Expect = 6e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +3 Query: 381 IQHLNITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 503 + HL+ITFRRDPTNYRPRINKLDSTKDREQK+AGSYYYLDD Sbjct: 565 LSHLDITFRRDPTNYRPRINKLDSTKDREQKNAGSYYYLDD 605 >dbj|BAD94217.1| RNase L inhibitor-like protein [Arabidopsis thaliana] Length = 357 Score = 83.6 bits (205), Expect = 6e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +3 Query: 381 IQHLNITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 503 + HLNITFRRDPTN+RPRINKL+STKDREQKSAGSYYYLDD Sbjct: 317 LSHLNITFRRDPTNFRPRINKLESTKDREQKSAGSYYYLDD 357 >emb|CAA16710.1| RNase L inhibitor-like protein [Arabidopsis thaliana] gi|7268716|emb|CAB78923.1| RNase L inhibitor-like protein [Arabidopsis thaliana] Length = 600 Score = 83.6 bits (205), Expect = 6e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +3 Query: 381 IQHLNITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 503 + HLNITFRRDPTN+RPRINKL+STKDREQKSAGSYYYLDD Sbjct: 560 LSHLNITFRRDPTNFRPRINKLESTKDREQKSAGSYYYLDD 600 >ref|NP_193656.2| RNAse l inhibitor protein 2 [Arabidopsis thaliana] gi|75330288|sp|Q8LPJ4.1|AB2E_ARATH RecName: Full=ABC transporter E family member 2; Short=ABC transporter ABCE.2; Short=AtABCE2; AltName: Full=RNase L inhibitor-like protein 2; Short=AtRLI2; Short=AthaRLI2 gi|20466462|gb|AAM20548.1| RNase L inhibitor-like protein [Arabidopsis thaliana] gi|23198180|gb|AAN15617.1| RNase L inhibitor-like protein [Arabidopsis thaliana] gi|110742163|dbj|BAE99009.1| RNase L inhibitor-like protein [Arabidopsis thaliana] gi|332658760|gb|AEE84160.1| RNAse l inhibitor protein 2 [Arabidopsis thaliana] Length = 605 Score = 83.6 bits (205), Expect = 6e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +3 Query: 381 IQHLNITFRRDPTNYRPRINKLDSTKDREQKSAGSYYYLDD 503 + HLNITFRRDPTN+RPRINKL+STKDREQKSAGSYYYLDD Sbjct: 565 LSHLNITFRRDPTNFRPRINKLESTKDREQKSAGSYYYLDD 605