BLASTX nr result
ID: Stemona21_contig00027351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00027351 (351 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003577423.1| PREDICTED: RING-H2 finger protein ATL32-like... 72 8e-11 gb|AFW65313.1| putative RING zinc finger domain superfamily prot... 70 3e-10 ref|NP_001151286.1| protein binding protein [Zea mays] gi|195645... 70 3e-10 ref|XP_006663552.1| PREDICTED: E3 ubiquitin-protein ligase RNF18... 69 5e-10 ref|XP_002449753.1| hypothetical protein SORBIDRAFT_05g022660 [S... 69 5e-10 ref|XP_004979603.1| PREDICTED: uncharacterized protein LOC101779... 69 6e-10 ref|XP_004979561.1| PREDICTED: E3 ubiquitin-protein ligase RNF11... 69 8e-10 ref|NP_001068155.1| Os11g0582100 [Oryza sativa Japonica Group] g... 68 1e-09 gb|EEE52343.1| hypothetical protein OsJ_34382 [Oryza sativa Japo... 68 1e-09 gb|AFK38133.1| unknown [Lotus japonicus] 67 3e-09 ref|XP_004496688.1| PREDICTED: E3 ubiquitin-protein ligase RNF12... 65 7e-09 gb|EAY81433.1| hypothetical protein OsI_36604 [Oryza sativa Indi... 64 2e-08 ref|XP_006838971.1| hypothetical protein AMTR_s00002p00271240 [A... 62 6e-08 ref|NP_001237666.1| uncharacterized protein LOC100527548 [Glycin... 62 6e-08 ref|XP_006489448.1| PREDICTED: RING-H2 finger protein ATL45-like... 62 8e-08 ref|XP_006420021.1| hypothetical protein CICLE_v10005915mg [Citr... 62 8e-08 ref|XP_004980652.1| PREDICTED: E3 ubiquitin-protein ligase Os03g... 62 8e-08 gb|ESW15297.1| hypothetical protein PHAVU_007G061000g [Phaseolus... 62 1e-07 gb|ACJ83283.1| unknown [Medicago truncatula] gi|217072378|gb|ACJ... 60 2e-07 ref|XP_006848840.1| hypothetical protein AMTR_s00026p00191500 [A... 60 4e-07 >ref|XP_003577423.1| PREDICTED: RING-H2 finger protein ATL32-like [Brachypodium distachyon] Length = 180 Score = 72.0 bits (175), Expect = 8e-11 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -3 Query: 340 WSRRRKGVMRLPCSHKYHSDCLLPWLAAHSHCPCCRTFVPSL 215 W RR++ V RLPCSH+YHSDC+LPWLA CPCCRT VPS+ Sbjct: 136 WERRQR-VTRLPCSHRYHSDCVLPWLAIQPDCPCCRTVVPSV 176 >gb|AFW65313.1| putative RING zinc finger domain superfamily protein [Zea mays] Length = 199 Score = 70.1 bits (170), Expect = 3e-10 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 331 RRKGVMRLPCSHKYHSDCLLPWLAAHSHCPCCRTFVPSL 215 R + V RLPCSHKYHS+C+LPWLA H CPCCR VPSL Sbjct: 155 RCQRVTRLPCSHKYHSECVLPWLAIHPDCPCCRALVPSL 193 >ref|NP_001151286.1| protein binding protein [Zea mays] gi|195645540|gb|ACG42238.1| protein binding protein [Zea mays] Length = 199 Score = 70.1 bits (170), Expect = 3e-10 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 331 RRKGVMRLPCSHKYHSDCLLPWLAAHSHCPCCRTFVPSL 215 R + V RLPCSHKYHS+C+LPWLA H CPCCR VPSL Sbjct: 155 RCQRVTRLPCSHKYHSECVLPWLAIHPDCPCCRALVPSL 193 >ref|XP_006663552.1| PREDICTED: E3 ubiquitin-protein ligase RNF181-like [Oryza brachyantha] Length = 174 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -3 Query: 331 RRKGVMRLPCSHKYHSDCLLPWLAAHSHCPCCRTFVPSLGD*F 203 R + V RLPCSHKYHS+C+LPWLA CPCCRT VPS+ F Sbjct: 130 RHQRVTRLPCSHKYHSECVLPWLAIQPDCPCCRTLVPSVDSLF 172 >ref|XP_002449753.1| hypothetical protein SORBIDRAFT_05g022660 [Sorghum bicolor] gi|241935596|gb|EES08741.1| hypothetical protein SORBIDRAFT_05g022660 [Sorghum bicolor] Length = 224 Score = 69.3 bits (168), Expect = 5e-10 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -3 Query: 334 RRRKGVMRLPCSHKYHSDCLLPWLAAHSHCPCCRTFVPS 218 R + V RLPCSHKYHS+C+LPWLA H CPCCR VPS Sbjct: 178 REDRRVTRLPCSHKYHSECVLPWLAIHPDCPCCRALVPS 216 >ref|XP_004979603.1| PREDICTED: uncharacterized protein LOC101779567 [Setaria italica] Length = 198 Score = 68.9 bits (167), Expect = 6e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -3 Query: 331 RRKGVMRLPCSHKYHSDCLLPWLAAHSHCPCCRTFVPS 218 RR+ V RLPCSHKYHSDC+LPWLA CPCCR VP+ Sbjct: 156 RRQRVTRLPCSHKYHSDCVLPWLAIQPDCPCCRALVPA 193 >ref|XP_004979561.1| PREDICTED: E3 ubiquitin-protein ligase RNF115-like [Setaria italica] Length = 196 Score = 68.6 bits (166), Expect = 8e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -3 Query: 331 RRKGVMRLPCSHKYHSDCLLPWLAAHSHCPCCRTFVPS 218 RR+ V RLPCSHKYHS+C+LPWLA CPCCR VPS Sbjct: 154 RRQRVTRLPCSHKYHSECVLPWLAIQPDCPCCRALVPS 191 >ref|NP_001068155.1| Os11g0582100 [Oryza sativa Japonica Group] gi|77551755|gb|ABA94552.1| Zinc finger, C3HC4 type family protein, expressed [Oryza sativa Japonica Group] gi|113645377|dbj|BAF28518.1| Os11g0582100 [Oryza sativa Japonica Group] gi|215697025|dbj|BAG91019.1| unnamed protein product [Oryza sativa Japonica Group] Length = 205 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -3 Query: 331 RRKGVMRLPCSHKYHSDCLLPWLAAHSHCPCCRTFVPSLGD*F 203 R + V RLPCSHKYHS+C+LPWLA CPCCRT VPS+ F Sbjct: 161 RHQRVTRLPCSHKYHSECVLPWLAIQPDCPCCRTQVPSVDSLF 203 >gb|EEE52343.1| hypothetical protein OsJ_34382 [Oryza sativa Japonica Group] Length = 202 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -3 Query: 331 RRKGVMRLPCSHKYHSDCLLPWLAAHSHCPCCRTFVPSLGD*F 203 R + V RLPCSHKYHS+C+LPWLA CPCCRT VPS+ F Sbjct: 158 RHQRVTRLPCSHKYHSECVLPWLAIQPDCPCCRTQVPSVDSLF 200 >gb|AFK38133.1| unknown [Lotus japonicus] Length = 152 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -3 Query: 334 RRRKGVMRLPCSHKYHSDCLLPWLAAHSHCPCCRTFV 224 ++++ VM L CSHKYHS CLLPWL AH HCPCCRT V Sbjct: 115 QQKQQVMNLSCSHKYHSACLLPWLEAHPHCPCCRTSV 151 >ref|XP_004496688.1| PREDICTED: E3 ubiquitin-protein ligase RNF128-like [Cicer arietinum] Length = 165 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -3 Query: 334 RRRKGVMRLPCSHKYHSDCLLPWLAAHSHCPCCRTFV 224 ++ K VM L CSHKYHS CLLPWL A+ HCPCCRT V Sbjct: 126 QQHKEVMNLSCSHKYHSACLLPWLRANPHCPCCRTMV 162 >gb|EAY81433.1| hypothetical protein OsI_36604 [Oryza sativa Indica Group] Length = 205 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = -3 Query: 331 RRKGVMRLPCSHKYHSDCLLPWLAAHSHCPCCRTFVPSLGD*F 203 R + V RLPCSHKYHS+C+LPWLA PCCRT VPS+ F Sbjct: 161 RHQRVTRLPCSHKYHSECVLPWLAIQPDWPCCRTQVPSVDSLF 203 >ref|XP_006838971.1| hypothetical protein AMTR_s00002p00271240 [Amborella trichopoda] gi|548841477|gb|ERN01540.1| hypothetical protein AMTR_s00002p00271240 [Amborella trichopoda] Length = 140 Score = 62.4 bits (150), Expect = 6e-08 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -3 Query: 325 KGVMRLPCSHKYHSDCLLPWLAAHSHCPCCRTFVP 221 +G+ RLPCSH YHS CLLPWL+ SHCP CR VP Sbjct: 100 EGLTRLPCSHSYHSHCLLPWLSRSSHCPYCRAHVP 134 >ref|NP_001237666.1| uncharacterized protein LOC100527548 [Glycine max] gi|255632588|gb|ACU16644.1| unknown [Glycine max] Length = 166 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 319 VMRLPCSHKYHSDCLLPWLAAHSHCPCCRT 230 VM L CSHKYHS CLLPWLAAH HCP CRT Sbjct: 133 VMNLSCSHKYHSACLLPWLAAHPHCPYCRT 162 >ref|XP_006489448.1| PREDICTED: RING-H2 finger protein ATL45-like [Citrus sinensis] Length = 203 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -3 Query: 319 VMRLPCSHKYHSDCLLPWLAAHSHCPCCR 233 V RLPCSHKYHSDC+LPWLAAH CP CR Sbjct: 169 VTRLPCSHKYHSDCVLPWLAAHPQCPYCR 197 >ref|XP_006420021.1| hypothetical protein CICLE_v10005915mg [Citrus clementina] gi|557521894|gb|ESR33261.1| hypothetical protein CICLE_v10005915mg [Citrus clementina] Length = 203 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -3 Query: 319 VMRLPCSHKYHSDCLLPWLAAHSHCPCCR 233 V RLPCSHKYHSDC+LPWLAAH CP CR Sbjct: 169 VTRLPCSHKYHSDCVLPWLAAHPQCPYCR 197 >ref|XP_004980652.1| PREDICTED: E3 ubiquitin-protein ligase Os03g0188200-like [Setaria italica] Length = 205 Score = 62.0 bits (149), Expect = 8e-08 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -3 Query: 310 LPCSHKYHSDCLLPWLAAHSHCPCCRTFVPS 218 LPCSH YH+ C+LPWLAAH CPCCR VPS Sbjct: 155 LPCSHSYHAGCVLPWLAAHGACPCCRATVPS 185 >gb|ESW15297.1| hypothetical protein PHAVU_007G061000g [Phaseolus vulgaris] Length = 159 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = -3 Query: 319 VMRLPCSHKYHSDCLLPWLAAHSHCPCCRTFV 224 VM L CSHKYHS CLLPWLA H HCP CRT V Sbjct: 126 VMNLSCSHKYHSACLLPWLATHPHCPYCRTAV 157 >gb|ACJ83283.1| unknown [Medicago truncatula] gi|217072378|gb|ACJ84549.1| unknown [Medicago truncatula] gi|388521239|gb|AFK48681.1| unknown [Medicago truncatula] Length = 161 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = -3 Query: 319 VMRLPCSHKYHSDCLLPWLAAHSHCPCCRTFV 224 VM L CSHKYHS CLLPWL H HCP CRT V Sbjct: 128 VMNLSCSHKYHSACLLPWLETHPHCPYCRTIV 159 >ref|XP_006848840.1| hypothetical protein AMTR_s00026p00191500 [Amborella trichopoda] gi|548852273|gb|ERN10421.1| hypothetical protein AMTR_s00026p00191500 [Amborella trichopoda] Length = 99 Score = 59.7 bits (143), Expect = 4e-07 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -3 Query: 319 VMRLPCSHKYHSDCLLPWLAAHSHCPCCRTFVP 221 ++ +PCSH +H +CL+PWL AHS CPCCRT VP Sbjct: 61 LVNMPCSHTFHFNCLVPWLQAHSVCPCCRTHVP 93