BLASTX nr result
ID: Stemona21_contig00026292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00026292 (285 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531372.1| dtdp-glucose 4-6-dehydratase, putative [Rici... 57 3e-06 gb|EXB58139.1| UDP-glucuronic acid decarboxylase 1 [Morus notabi... 56 4e-06 gb|EMT27519.1| UDP-glucuronic acid decarboxylase 1 [Aegilops tau... 55 1e-05 gb|EMS54364.1| UDP-glucuronic acid decarboxylase 1 [Triticum ura... 55 1e-05 >ref|XP_002531372.1| dtdp-glucose 4-6-dehydratase, putative [Ricinus communis] gi|223529032|gb|EEF31020.1| dtdp-glucose 4-6-dehydratase, putative [Ricinus communis] Length = 346 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/36 (77%), Positives = 31/36 (86%), Gaps = 4/36 (11%) Frame = +2 Query: 188 AKDSANG----ATKPPPSPSPLRNSKFFQANMRILV 283 AK+S+NG TKPPPSPSPLRNSKFFQ+NMRILV Sbjct: 2 AKNSSNGDHQTTTKPPPSPSPLRNSKFFQSNMRILV 37 >gb|EXB58139.1| UDP-glucuronic acid decarboxylase 1 [Morus notabilis] Length = 346 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/36 (75%), Positives = 32/36 (88%), Gaps = 4/36 (11%) Frame = +2 Query: 188 AKDSANG----ATKPPPSPSPLRNSKFFQANMRILV 283 AK+++NG ATKPPP+PSPLRN+KFFQANMRILV Sbjct: 2 AKETSNGGSHVATKPPPTPSPLRNAKFFQANMRILV 37 >gb|EMT27519.1| UDP-glucuronic acid decarboxylase 1 [Aegilops tauschii] Length = 386 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/37 (72%), Positives = 31/37 (83%), Gaps = 3/37 (8%) Frame = +2 Query: 182 MAAKDSANG---ATKPPPSPSPLRNSKFFQANMRILV 283 MA KD+ANG T+PPP+PSP+R SKFFQANMRILV Sbjct: 1 MAQKDAANGNGATTRPPPTPSPIRFSKFFQANMRILV 37 >gb|EMS54364.1| UDP-glucuronic acid decarboxylase 1 [Triticum urartu] Length = 348 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/37 (72%), Positives = 31/37 (83%), Gaps = 3/37 (8%) Frame = +2 Query: 182 MAAKDSANG---ATKPPPSPSPLRNSKFFQANMRILV 283 MA KD+ANG T+PPP+PSP+R SKFFQANMRILV Sbjct: 1 MAQKDAANGNGATTRPPPTPSPIRFSKFFQANMRILV 37