BLASTX nr result
ID: Stemona21_contig00026228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00026228 (456 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW33980.1| hypothetical protein PHAVU_001G114500g [Phaseolus... 91 2e-16 gb|EMS55013.1| Uridine kinase-like protein 2, chloroplastic [Tri... 91 2e-16 ref|XP_006353646.1| PREDICTED: uridine kinase-like protein 1, ch... 91 2e-16 gb|EPS57314.1| hypothetical protein M569_17504, partial [Genlise... 91 2e-16 ref|XP_006470040.1| PREDICTED: uridine kinase-like protein 1, ch... 90 3e-16 ref|XP_006470039.1| PREDICTED: uridine kinase-like protein 1, ch... 90 3e-16 ref|XP_006447097.1| hypothetical protein CICLE_v10015123mg [Citr... 90 3e-16 ref|XP_006447096.1| hypothetical protein CICLE_v10015123mg [Citr... 90 3e-16 ref|XP_006447095.1| hypothetical protein CICLE_v10015123mg [Citr... 90 3e-16 tpg|DAA48194.2| TPA: hypothetical protein ZEAMMB73_148033 [Zea m... 90 3e-16 gb|ACF85170.1| unknown [Zea mays] 90 3e-16 ref|NP_001130756.1| uncharacterized protein LOC100191860 [Zea ma... 90 3e-16 ref|XP_003547653.1| PREDICTED: uridine kinase-like protein 1, ch... 90 4e-16 ref|XP_003553920.1| PREDICTED: uridine kinase-like protein 1, ch... 90 4e-16 gb|EOY02767.1| Uridine kinase/uracil phosphoribosyltransferase 1... 89 5e-16 ref|XP_004241807.1| PREDICTED: uridine kinase-like protein 1, ch... 89 5e-16 ref|XP_003633788.1| PREDICTED: uridine kinase-like protein 1, ch... 89 5e-16 ref|XP_003633787.1| PREDICTED: uridine kinase-like protein 1, ch... 89 5e-16 emb|CBI40048.3| unnamed protein product [Vitis vinifera] 89 5e-16 emb|CBI40047.3| unnamed protein product [Vitis vinifera] 89 5e-16 >gb|ESW33980.1| hypothetical protein PHAVU_001G114500g [Phaseolus vulgaris] Length = 473 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -3 Query: 454 GIHCVCKRFPYVKIVTSEIDVGLNEEYRVIPGLGEFGDRYFGTDE 320 GIHCVCKRFP +KIVTSEIDV LNEEYRVIPGLGEFGDRYFGTD+ Sbjct: 429 GIHCVCKRFPSLKIVTSEIDVELNEEYRVIPGLGEFGDRYFGTDD 473 >gb|EMS55013.1| Uridine kinase-like protein 2, chloroplastic [Triticum urartu] Length = 408 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -3 Query: 454 GIHCVCKRFPYVKIVTSEIDVGLNEEYRVIPGLGEFGDRYFGTD 323 GIHCVCKRFP VKIVTSEID GLNEEYRV+PGLGE+GDRYFGTD Sbjct: 365 GIHCVCKRFPGVKIVTSEIDAGLNEEYRVVPGLGEYGDRYFGTD 408 >ref|XP_006353646.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like [Solanum tuberosum] Length = 485 Score = 90.5 bits (223), Expect = 2e-16 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -3 Query: 454 GIHCVCKRFPYVKIVTSEIDVGLNEEYRVIPGLGEFGDRYFGTDE 320 GIHCVCKRFP +KIVTSEID+ LNEEYRVIPGLGEFGDRYFGTD+ Sbjct: 441 GIHCVCKRFPSLKIVTSEIDLSLNEEYRVIPGLGEFGDRYFGTDD 485 >gb|EPS57314.1| hypothetical protein M569_17504, partial [Genlisea aurea] Length = 77 Score = 90.5 bits (223), Expect = 2e-16 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -3 Query: 454 GIHCVCKRFPYVKIVTSEIDVGLNEEYRVIPGLGEFGDRYFGTDE 320 GIHCVC+RFP +KIVTSEIDVGLN+EYRVIPG+GEFGDRYFGTD+ Sbjct: 33 GIHCVCRRFPDLKIVTSEIDVGLNDEYRVIPGMGEFGDRYFGTDD 77 >ref|XP_006470040.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like isoform X3 [Citrus sinensis] Length = 454 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -3 Query: 454 GIHCVCKRFPYVKIVTSEIDVGLNEEYRVIPGLGEFGDRYFGTDE 320 GIHCVCKRFP +KIVTSEIDV LNEE+RVIPGLGEFGDRYFGTD+ Sbjct: 410 GIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTDD 454 >ref|XP_006470039.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like isoform X2 [Citrus sinensis] Length = 471 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -3 Query: 454 GIHCVCKRFPYVKIVTSEIDVGLNEEYRVIPGLGEFGDRYFGTDE 320 GIHCVCKRFP +KIVTSEIDV LNEE+RVIPGLGEFGDRYFGTD+ Sbjct: 427 GIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTDD 471 >ref|XP_006447097.1| hypothetical protein CICLE_v10015123mg [Citrus clementina] gi|568831582|ref|XP_006470041.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like isoform X4 [Citrus sinensis] gi|557549708|gb|ESR60337.1| hypothetical protein CICLE_v10015123mg [Citrus clementina] Length = 453 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -3 Query: 454 GIHCVCKRFPYVKIVTSEIDVGLNEEYRVIPGLGEFGDRYFGTDE 320 GIHCVCKRFP +KIVTSEIDV LNEE+RVIPGLGEFGDRYFGTD+ Sbjct: 409 GIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTDD 453 >ref|XP_006447096.1| hypothetical protein CICLE_v10015123mg [Citrus clementina] gi|568831576|ref|XP_006470038.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like isoform X1 [Citrus sinensis] gi|557549707|gb|ESR60336.1| hypothetical protein CICLE_v10015123mg [Citrus clementina] Length = 472 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -3 Query: 454 GIHCVCKRFPYVKIVTSEIDVGLNEEYRVIPGLGEFGDRYFGTDE 320 GIHCVCKRFP +KIVTSEIDV LNEE+RVIPGLGEFGDRYFGTD+ Sbjct: 428 GIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTDD 472 >ref|XP_006447095.1| hypothetical protein CICLE_v10015123mg [Citrus clementina] gi|557549706|gb|ESR60335.1| hypothetical protein CICLE_v10015123mg [Citrus clementina] Length = 463 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -3 Query: 454 GIHCVCKRFPYVKIVTSEIDVGLNEEYRVIPGLGEFGDRYFGTDE 320 GIHCVCKRFP +KIVTSEIDV LNEE+RVIPGLGEFGDRYFGTD+ Sbjct: 419 GIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTDD 463 >tpg|DAA48194.2| TPA: hypothetical protein ZEAMMB73_148033 [Zea mays] gi|552572573|tpg|DAA48195.2| TPA: hypothetical protein ZEAMMB73_148033 [Zea mays] Length = 300 Score = 90.1 bits (222), Expect = 3e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -3 Query: 454 GIHCVCKRFPYVKIVTSEIDVGLNEEYRVIPGLGEFGDRYFGTD 323 GIHCVCKRFP++KIVTSEID GLN+EYRVIPGLGE+GDRYFGTD Sbjct: 257 GIHCVCKRFPHLKIVTSEIDSGLNDEYRVIPGLGEYGDRYFGTD 300 >gb|ACF85170.1| unknown [Zea mays] Length = 479 Score = 90.1 bits (222), Expect = 3e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -3 Query: 454 GIHCVCKRFPYVKIVTSEIDVGLNEEYRVIPGLGEFGDRYFGTD 323 GIHCVCKRFP++KIVTSEID GLN+EYRVIPGLGE+GDRYFGTD Sbjct: 436 GIHCVCKRFPHLKIVTSEIDSGLNDEYRVIPGLGEYGDRYFGTD 479 >ref|NP_001130756.1| uncharacterized protein LOC100191860 [Zea mays] gi|194690030|gb|ACF79099.1| unknown [Zea mays] Length = 479 Score = 90.1 bits (222), Expect = 3e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -3 Query: 454 GIHCVCKRFPYVKIVTSEIDVGLNEEYRVIPGLGEFGDRYFGTD 323 GIHCVCKRFP++KIVTSEID GLN+EYRVIPGLGE+GDRYFGTD Sbjct: 436 GIHCVCKRFPHLKIVTSEIDSGLNDEYRVIPGLGEYGDRYFGTD 479 >ref|XP_003547653.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like [Glycine max] Length = 474 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 454 GIHCVCKRFPYVKIVTSEIDVGLNEEYRVIPGLGEFGDRYFGTDE 320 GIHCVCKRFP +KIVTSEID+ +NEEYRVIPGLGEFGDRYFGTD+ Sbjct: 430 GIHCVCKRFPSLKIVTSEIDIEINEEYRVIPGLGEFGDRYFGTDD 474 >ref|XP_003553920.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like [Glycine max] Length = 476 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 454 GIHCVCKRFPYVKIVTSEIDVGLNEEYRVIPGLGEFGDRYFGTDE 320 GIHCVCKRFP +KIVTSEID+ +NEEYRVIPGLGEFGDRYFGTD+ Sbjct: 432 GIHCVCKRFPSLKIVTSEIDIEINEEYRVIPGLGEFGDRYFGTDD 476 >gb|EOY02767.1| Uridine kinase/uracil phosphoribosyltransferase 1 isoform 1 [Theobroma cacao] Length = 466 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 454 GIHCVCKRFPYVKIVTSEIDVGLNEEYRVIPGLGEFGDRYFGTDE 320 GIHCVCKRFP +KIVTSEIDV LNEE+RVIPG+GEFGDRYFGTD+ Sbjct: 422 GIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGMGEFGDRYFGTDD 466 >ref|XP_004241807.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like [Solanum lycopersicum] Length = 483 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = -3 Query: 454 GIHCVCKRFPYVKIVTSEIDVGLNEEYRVIPGLGEFGDRYFGTDE 320 GIHCVCKRFP +KIVTSEID LNEEYRVIPGLGEFGDRYFGTD+ Sbjct: 439 GIHCVCKRFPSLKIVTSEIDQSLNEEYRVIPGLGEFGDRYFGTDD 483 >ref|XP_003633788.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like isoform 2 [Vitis vinifera] Length = 481 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 454 GIHCVCKRFPYVKIVTSEIDVGLNEEYRVIPGLGEFGDRYFGTDE 320 GIHCVCKRFP +KIVTSEIDV LNEE+RVIPG+GEFGDRYFGTD+ Sbjct: 437 GIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGMGEFGDRYFGTDD 481 >ref|XP_003633787.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like isoform 1 [Vitis vinifera] Length = 482 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 454 GIHCVCKRFPYVKIVTSEIDVGLNEEYRVIPGLGEFGDRYFGTDE 320 GIHCVCKRFP +KIVTSEIDV LNEE+RVIPG+GEFGDRYFGTD+ Sbjct: 438 GIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGMGEFGDRYFGTDD 482 >emb|CBI40048.3| unnamed protein product [Vitis vinifera] Length = 267 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 454 GIHCVCKRFPYVKIVTSEIDVGLNEEYRVIPGLGEFGDRYFGTDE 320 GIHCVCKRFP +KIVTSEIDV LNEE+RVIPG+GEFGDRYFGTD+ Sbjct: 223 GIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGMGEFGDRYFGTDD 267 >emb|CBI40047.3| unnamed protein product [Vitis vinifera] Length = 896 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 454 GIHCVCKRFPYVKIVTSEIDVGLNEEYRVIPGLGEFGDRYFGTDE 320 GIHCVCKRFP +KIVTSEIDV LNEE+RVIPG+GEFGDRYFGTD+ Sbjct: 852 GIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGMGEFGDRYFGTDD 896