BLASTX nr result
ID: Stemona21_contig00026136
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00026136 (349 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT24510.1| Putative metal-nicotianamine transporter YSL13 [A... 59 5e-07 ref|XP_004978143.1| PREDICTED: probable metal-nicotianamine tran... 59 9e-07 tpg|DAA36870.1| TPA: hypothetical protein ZEAMMB73_694828 [Zea m... 59 9e-07 ref|XP_002449540.1| hypothetical protein SORBIDRAFT_05g018520 [S... 59 9e-07 gb|EMS52213.1| putative metal-nicotianamine transporter YSL13 [T... 58 1e-06 gb|EAZ31384.1| hypothetical protein OsJ_15512 [Oryza sativa Japo... 58 1e-06 emb|CAH67885.1| OSIGBa0153E02-OSIGBa0093I20.14 [Oryza sativa Ind... 58 1e-06 ref|NP_001053350.1| Os04g0524500 [Oryza sativa Japonica Group] g... 58 1e-06 sp|Q7XKF4.2|YSL13_ORYSJ RecName: Full=Probable metal-nicotianami... 58 1e-06 ref|XP_006652534.1| PREDICTED: probable metal-nicotianamine tran... 57 3e-06 ref|XP_003581442.1| PREDICTED: probable metal-nicotianamine tran... 57 3e-06 ref|NP_001185468.1| yellow stripe-like transporter 12 [Zea mays]... 56 6e-06 ref|XP_002446809.1| hypothetical protein SORBIDRAFT_06g023010 [S... 56 6e-06 gb|EEC77667.1| hypothetical protein OsI_16700 [Oryza sativa Indi... 56 6e-06 sp|Q5JQD7.2|YSL12_ORYSJ RecName: Full=Probable metal-nicotianami... 56 6e-06 ref|NP_001053351.1| Os04g0524600 [Oryza sativa Japonica Group] g... 56 6e-06 dbj|BAE91892.1| hypothetical protein [Oryza sativa Japonica Group] 56 6e-06 emb|CAI44637.1| OSJNBb0065J09.17 [Oryza sativa Japonica Group] 56 6e-06 gb|ADE77032.1| unknown [Picea sitchensis] 55 7e-06 >gb|EMT24510.1| Putative metal-nicotianamine transporter YSL13 [Aegilops tauschii] Length = 727 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 349 PQSVLALAKVKPPICMKFLSREMNDKVDGF 260 PQSVLALAKVKPPICMKFLSR MNDKVD F Sbjct: 693 PQSVLALAKVKPPICMKFLSRGMNDKVDAF 722 >ref|XP_004978143.1| PREDICTED: probable metal-nicotianamine transporter YSL13-like [Setaria italica] Length = 733 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 349 PQSVLALAKVKPPICMKFLSREMNDKVDGF 260 PQS+LALAKVKPPICMKFLSR MNDKVD F Sbjct: 699 PQSLLALAKVKPPICMKFLSRTMNDKVDAF 728 >tpg|DAA36870.1| TPA: hypothetical protein ZEAMMB73_694828 [Zea mays] Length = 725 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 349 PQSVLALAKVKPPICMKFLSREMNDKVDGF 260 PQSVLALAKVKPPICMKFLSR MNDKVD F Sbjct: 693 PQSVLALAKVKPPICMKFLSRAMNDKVDVF 722 >ref|XP_002449540.1| hypothetical protein SORBIDRAFT_05g018520 [Sorghum bicolor] gi|241935383|gb|EES08528.1| hypothetical protein SORBIDRAFT_05g018520 [Sorghum bicolor] Length = 722 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 349 PQSVLALAKVKPPICMKFLSREMNDKVDGF 260 PQSVLALAKVKPPICM+FLSR MNDKVD F Sbjct: 690 PQSVLALAKVKPPICMRFLSRAMNDKVDAF 719 >gb|EMS52213.1| putative metal-nicotianamine transporter YSL13 [Triticum urartu] Length = 620 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 349 PQSVLALAKVKPPICMKFLSREMNDKVDGF 260 PQSVLALAKVKPPICMKFLSR +NDKVD F Sbjct: 586 PQSVLALAKVKPPICMKFLSRGVNDKVDAF 615 >gb|EAZ31384.1| hypothetical protein OsJ_15512 [Oryza sativa Japonica Group] Length = 724 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -1 Query: 349 PQSVLALAKVKPPICMKFLSREMNDKVDGF 260 PQSVLALAKVKPPICMKFLSR NDKVD F Sbjct: 689 PQSVLALAKVKPPICMKFLSRRTNDKVDAF 718 >emb|CAH67885.1| OSIGBa0153E02-OSIGBa0093I20.14 [Oryza sativa Indica Group] gi|125549076|gb|EAY94898.1| hypothetical protein OsI_16698 [Oryza sativa Indica Group] Length = 724 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -1 Query: 349 PQSVLALAKVKPPICMKFLSREMNDKVDGF 260 PQSVLALAKVKPPICMKFLSR NDKVD F Sbjct: 689 PQSVLALAKVKPPICMKFLSRRTNDKVDAF 718 >ref|NP_001053350.1| Os04g0524500 [Oryza sativa Japonica Group] gi|113564921|dbj|BAF15264.1| Os04g0524500, partial [Oryza sativa Japonica Group] Length = 629 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -1 Query: 349 PQSVLALAKVKPPICMKFLSREMNDKVDGF 260 PQSVLALAKVKPPICMKFLSR NDKVD F Sbjct: 594 PQSVLALAKVKPPICMKFLSRRTNDKVDAF 623 >sp|Q7XKF4.2|YSL13_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL13; AltName: Full=Protein YELLOW STRIPE LIKE 13; Short=OsYSL13 gi|57834124|emb|CAE05719.2| OSJNBb0065J09.15 [Oryza sativa Japonica Group] gi|74267414|dbj|BAE44204.1| hypothetical protein [Oryza sativa Japonica Group] Length = 724 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -1 Query: 349 PQSVLALAKVKPPICMKFLSREMNDKVDGF 260 PQSVLALAKVKPPICMKFLSR NDKVD F Sbjct: 689 PQSVLALAKVKPPICMKFLSRRTNDKVDAF 718 >ref|XP_006652534.1| PREDICTED: probable metal-nicotianamine transporter YSL13-like [Oryza brachyantha] Length = 510 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -1 Query: 349 PQSVLALAKVKPPICMKFLSREMNDKVDGF 260 PQSVLALAKVKPPICMKFLSR NDKVD F Sbjct: 476 PQSVLALAKVKPPICMKFLSRRTNDKVDVF 505 >ref|XP_003581442.1| PREDICTED: probable metal-nicotianamine transporter YSL13-like [Brachypodium distachyon] Length = 724 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 349 PQSVLALAKVKPPICMKFLSREMNDKVDGF 260 PQSVLALAKVKPPICMKFL+R MN+KVD F Sbjct: 690 PQSVLALAKVKPPICMKFLARGMNEKVDAF 719 >ref|NP_001185468.1| yellow stripe-like transporter 12 [Zea mays] gi|308210136|gb|ADO20999.1| yellow stripe-like transporter 12 [Zea mays] gi|413918964|gb|AFW58896.1| hypothetical protein ZEAMMB73_279911 [Zea mays] Length = 718 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 349 PQSVLALAKVKPPICMKFLSREMNDKVDGF 260 PQS+LALAKVKPPICMKFLSR +N +VDGF Sbjct: 686 PQSILALAKVKPPICMKFLSRSVNAQVDGF 715 >ref|XP_002446809.1| hypothetical protein SORBIDRAFT_06g023010 [Sorghum bicolor] gi|241937992|gb|EES11137.1| hypothetical protein SORBIDRAFT_06g023010 [Sorghum bicolor] Length = 722 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 349 PQSVLALAKVKPPICMKFLSREMNDKVDGF 260 PQS+LALAKVKPPICMKFLSR +N +VDGF Sbjct: 690 PQSILALAKVKPPICMKFLSRSVNAQVDGF 719 >gb|EEC77667.1| hypothetical protein OsI_16700 [Oryza sativa Indica Group] Length = 576 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 349 PQSVLALAKVKPPICMKFLSREMNDKVDGF 260 PQS+LALAKVKPPICMKFLSR +N +VDGF Sbjct: 544 PQSILALAKVKPPICMKFLSRSVNAQVDGF 573 >sp|Q5JQD7.2|YSL12_ORYSJ RecName: Full=Probable metal-nicotianamine transporter YSL12; AltName: Full=Protein YELLOW STRIPE LIKE 12; Short=OsYSL12 gi|116310949|emb|CAH67886.1| OSIGBa0153E02-OSIGBa0093I20.15 [Oryza sativa Indica Group] Length = 717 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 349 PQSVLALAKVKPPICMKFLSREMNDKVDGF 260 PQS+LALAKVKPPICMKFLSR +N +VDGF Sbjct: 685 PQSILALAKVKPPICMKFLSRSVNAQVDGF 714 >ref|NP_001053351.1| Os04g0524600 [Oryza sativa Japonica Group] gi|113564922|dbj|BAF15265.1| Os04g0524600 [Oryza sativa Japonica Group] gi|222629234|gb|EEE61366.1| hypothetical protein OsJ_15514 [Oryza sativa Japonica Group] Length = 576 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 349 PQSVLALAKVKPPICMKFLSREMNDKVDGF 260 PQS+LALAKVKPPICMKFLSR +N +VDGF Sbjct: 544 PQSILALAKVKPPICMKFLSRSVNAQVDGF 573 >dbj|BAE91892.1| hypothetical protein [Oryza sativa Japonica Group] Length = 716 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 349 PQSVLALAKVKPPICMKFLSREMNDKVDGF 260 PQS+LALAKVKPPICMKFLSR +N +VDGF Sbjct: 684 PQSILALAKVKPPICMKFLSRSVNAQVDGF 713 >emb|CAI44637.1| OSJNBb0065J09.17 [Oryza sativa Japonica Group] Length = 672 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 349 PQSVLALAKVKPPICMKFLSREMNDKVDGF 260 PQS+LALAKVKPPICMKFLSR +N +VDGF Sbjct: 640 PQSILALAKVKPPICMKFLSRSVNAQVDGF 669 >gb|ADE77032.1| unknown [Picea sitchensis] Length = 210 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 349 PQSVLALAKVKPPICMKFLSREMNDKVDGF 260 P S+LALAKV PPICMKFLSR MN KVDGF Sbjct: 177 PSSILALAKVNPPICMKFLSRNMNTKVDGF 206