BLASTX nr result
ID: Stemona21_contig00025352
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00025352 (318 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004134221.1| PREDICTED: dynein light chain 1, cytoplasmic... 60 3e-07 gb|ESW10924.1| hypothetical protein PHAVU_009G249900g [Phaseolus... 60 4e-07 gb|ESW10923.1| hypothetical protein PHAVU_009G249800g [Phaseolus... 60 4e-07 ref|XP_006414418.1| hypothetical protein EUTSA_v10026570mg [Eutr... 60 4e-07 ref|XP_004508201.1| PREDICTED: dynein light chain 2, cytoplasmic... 60 4e-07 ref|XP_006284766.1| hypothetical protein CARUB_v10006033mg [Caps... 60 4e-07 ref|XP_004296858.1| PREDICTED: dynein light chain 1, cytoplasmic... 60 4e-07 gb|EMJ24678.1| hypothetical protein PRUPE_ppa013502mg [Prunus pe... 60 4e-07 ref|XP_004150499.1| PREDICTED: dynein light chain 1, cytoplasmic... 60 4e-07 gb|AFY26900.1| dynein light chain [Morella rubra] 60 4e-07 ref|NP_193328.4| dynein light chain LC8-type [Arabidopsis thali... 60 4e-07 pir||B71425 hypothetical protein - Arabidopsis thaliana 60 4e-07 gb|AFK44581.1| unknown [Lotus japonicus] 60 4e-07 ref|XP_003546364.1| PREDICTED: dynein light chain 2, cytoplasmic... 60 4e-07 ref|XP_003533298.1| PREDICTED: dynein light chain 2, cytoplasmic... 60 4e-07 ref|XP_003609697.1| Dynein light chain 1 cytoplasmic-like protei... 60 4e-07 emb|CBI22981.3| unnamed protein product [Vitis vinifera] 60 4e-07 ref|NP_001238295.1| uncharacterized protein LOC100527842 [Glycin... 60 4e-07 ref|NP_001238570.1| uncharacterized protein LOC100305908 [Glycin... 60 4e-07 ref|XP_002328627.1| predicted protein [Populus trichocarpa] gi|1... 60 4e-07 >ref|XP_004134221.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Cucumis sativus] gi|449515341|ref|XP_004164708.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Cucumis sativus] Length = 120 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 RNFGSYVTHETSHFIYFYVDMKAFLLFKSG 92 RNFGSYVTHET+HF+YFY+D KA LLFKSG Sbjct: 91 RNFGSYVTHETNHFVYFYLDQKAILLFKSG 120 >gb|ESW10924.1| hypothetical protein PHAVU_009G249900g [Phaseolus vulgaris] Length = 118 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 RNFGSYVTHETSHFIYFYVDMKAFLLFKSG 92 RNFGSYVTHET+HF+YFY+D KA LLFKSG Sbjct: 89 RNFGSYVTHETNHFVYFYLDQKAVLLFKSG 118 >gb|ESW10923.1| hypothetical protein PHAVU_009G249800g [Phaseolus vulgaris] Length = 120 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 RNFGSYVTHETSHFIYFYVDMKAFLLFKSG 92 RNFGSYVTHET+HF+YFY+D KA LLFKSG Sbjct: 91 RNFGSYVTHETNHFVYFYLDQKAVLLFKSG 120 >ref|XP_006414418.1| hypothetical protein EUTSA_v10026570mg [Eutrema salsugineum] gi|557115588|gb|ESQ55871.1| hypothetical protein EUTSA_v10026570mg [Eutrema salsugineum] Length = 123 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 RNFGSYVTHETSHFIYFYVDMKAFLLFKSG 92 RNFGSYVTHET+HF+YFY+D KA LLFKSG Sbjct: 94 RNFGSYVTHETNHFVYFYLDQKAVLLFKSG 123 >ref|XP_004508201.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Cicer arietinum] Length = 135 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 RNFGSYVTHETSHFIYFYVDMKAFLLFKSG 92 RNFGSYVTHET+HF+YFY+D KA LLFKSG Sbjct: 106 RNFGSYVTHETNHFVYFYLDQKAVLLFKSG 135 >ref|XP_006284766.1| hypothetical protein CARUB_v10006033mg [Capsella rubella] gi|482553471|gb|EOA17664.1| hypothetical protein CARUB_v10006033mg [Capsella rubella] Length = 123 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 RNFGSYVTHETSHFIYFYVDMKAFLLFKSG 92 RNFGSYVTHET+HF+YFY+D KA LLFKSG Sbjct: 94 RNFGSYVTHETNHFVYFYLDQKAVLLFKSG 123 >ref|XP_004296858.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Fragaria vesca subsp. vesca] Length = 120 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 RNFGSYVTHETSHFIYFYVDMKAFLLFKSG 92 RNFGSYVTHET+HF+YFY+D KA LLFKSG Sbjct: 91 RNFGSYVTHETNHFVYFYLDQKAVLLFKSG 120 >gb|EMJ24678.1| hypothetical protein PRUPE_ppa013502mg [Prunus persica] Length = 119 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 RNFGSYVTHETSHFIYFYVDMKAFLLFKSG 92 RNFGSYVTHET+HF+YFY+D KA LLFKSG Sbjct: 90 RNFGSYVTHETNHFVYFYLDQKAVLLFKSG 119 >ref|XP_004150499.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Cucumis sativus] gi|449528079|ref|XP_004171034.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Cucumis sativus] Length = 117 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 RNFGSYVTHETSHFIYFYVDMKAFLLFKSG 92 RNFGSYVTHET+HF+YFY+D KA LLFKSG Sbjct: 88 RNFGSYVTHETNHFVYFYLDQKAVLLFKSG 117 >gb|AFY26900.1| dynein light chain [Morella rubra] Length = 125 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 RNFGSYVTHETSHFIYFYVDMKAFLLFKSG 92 RNFGSYVTHET+HF+YFY+D KA LLFKSG Sbjct: 96 RNFGSYVTHETNHFVYFYLDQKAVLLFKSG 125 >ref|NP_193328.4| dynein light chain LC8-type [Arabidopsis thaliana] gi|28466885|gb|AAO44051.1| At4g15930 [Arabidopsis thaliana] gi|332658267|gb|AEE83667.1| dynein light chain LC8-type [Arabidopsis thaliana] Length = 123 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 RNFGSYVTHETSHFIYFYVDMKAFLLFKSG 92 RNFGSYVTHET+HF+YFY+D KA LLFKSG Sbjct: 94 RNFGSYVTHETNHFVYFYLDQKAVLLFKSG 123 >pir||B71425 hypothetical protein - Arabidopsis thaliana Length = 67 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 RNFGSYVTHETSHFIYFYVDMKAFLLFKSG 92 RNFGSYVTHET+HF+YFY+D KA LLFKSG Sbjct: 38 RNFGSYVTHETNHFVYFYLDQKAVLLFKSG 67 >gb|AFK44581.1| unknown [Lotus japonicus] Length = 142 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 RNFGSYVTHETSHFIYFYVDMKAFLLFKSG 92 RNFGSYVTHET+HF+YFY+D KA LLFKSG Sbjct: 113 RNFGSYVTHETNHFVYFYLDQKAVLLFKSG 142 >ref|XP_003546364.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Glycine max] Length = 122 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 RNFGSYVTHETSHFIYFYVDMKAFLLFKSG 92 RNFGSYVTHET+HF+YFY+D KA LLFKSG Sbjct: 93 RNFGSYVTHETNHFVYFYLDQKAVLLFKSG 122 >ref|XP_003533298.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Glycine max] Length = 157 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 RNFGSYVTHETSHFIYFYVDMKAFLLFKSG 92 RNFGSYVTHET+HF+YFY+D KA LLFKSG Sbjct: 128 RNFGSYVTHETNHFVYFYLDQKAVLLFKSG 157 >ref|XP_003609697.1| Dynein light chain 1 cytoplasmic-like protein [Medicago truncatula] gi|355510752|gb|AES91894.1| Dynein light chain 1 cytoplasmic-like protein [Medicago truncatula] gi|388518223|gb|AFK47173.1| unknown [Medicago truncatula] Length = 130 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 RNFGSYVTHETSHFIYFYVDMKAFLLFKSG 92 RNFGSYVTHET+HF+YFY+D KA LLFKSG Sbjct: 101 RNFGSYVTHETNHFVYFYLDQKAVLLFKSG 130 >emb|CBI22981.3| unnamed protein product [Vitis vinifera] Length = 73 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 RNFGSYVTHETSHFIYFYVDMKAFLLFKSG 92 RNFGSYVTHET+HF+YFY+D KA LLFKSG Sbjct: 44 RNFGSYVTHETNHFVYFYLDQKAVLLFKSG 73 >ref|NP_001238295.1| uncharacterized protein LOC100527842 [Glycine max] gi|255633354|gb|ACU17034.1| unknown [Glycine max] Length = 118 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 RNFGSYVTHETSHFIYFYVDMKAFLLFKSG 92 RNFGSYVTHET+HF+YFY+D KA LLFKSG Sbjct: 89 RNFGSYVTHETNHFVYFYLDQKAVLLFKSG 118 >ref|NP_001238570.1| uncharacterized protein LOC100305908 [Glycine max] gi|255626947|gb|ACU13818.1| unknown [Glycine max] Length = 118 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 RNFGSYVTHETSHFIYFYVDMKAFLLFKSG 92 RNFGSYVTHET+HF+YFY+D KA LLFKSG Sbjct: 89 RNFGSYVTHETNHFVYFYLDQKAVLLFKSG 118 >ref|XP_002328627.1| predicted protein [Populus trichocarpa] gi|118482080|gb|ABK92971.1| unknown [Populus trichocarpa] Length = 120 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 RNFGSYVTHETSHFIYFYVDMKAFLLFKSG 92 RNFGSYVTHET+HF+YFY+D KA LLFKSG Sbjct: 91 RNFGSYVTHETNHFVYFYLDQKAVLLFKSG 120