BLASTX nr result
ID: Stemona21_contig00024477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00024477 (346 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB62181.1| hypothetical protein L484_017568 [Morus notabilis] 66 5e-09 ref|XP_002320200.2| hypothetical protein POPTR_0014s09410g [Popu... 60 3e-07 ref|XP_006444841.1| hypothetical protein CICLE_v10018452mg [Citr... 60 4e-07 ref|XP_002523351.1| eukaryotic translation initiation factor 3 s... 59 5e-07 ref|XP_006386627.1| hypothetical protein POPTR_0002s17200g [Popu... 59 7e-07 gb|EOX95712.1| Tetratricopeptide repeat (TPR)-like superfamily p... 59 7e-07 gb|EOX95711.1| Tetratricopeptide repeat (TPR)-like superfamily p... 59 7e-07 gb|EOX95710.1| Tetratricopeptide repeat (TPR)-like superfamily p... 59 7e-07 ref|XP_002278370.2| PREDICTED: protein KIAA0664 homolog [Vitis v... 59 7e-07 ref|XP_004157615.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 58 1e-06 ref|XP_004140673.1| PREDICTED: uncharacterized protein LOC101210... 58 1e-06 ref|XP_006852659.1| hypothetical protein AMTR_s00021p00245460 [A... 57 3e-06 gb|EMJ21637.1| hypothetical protein PRUPE_ppa000096mg [Prunus pe... 55 7e-06 >gb|EXB62181.1| hypothetical protein L484_017568 [Morus notabilis] Length = 1098 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = +3 Query: 3 PISLLSRPYGSQSFKVIYSRVVRGSDIPEQTTTLASEDSTVS 128 PISLLSRPYGSQSFKVIY+RVVRGSD+P+ T+ ++ED T S Sbjct: 1055 PISLLSRPYGSQSFKVIYNRVVRGSDVPKTTSFSSTEDCTAS 1096 >ref|XP_002320200.2| hypothetical protein POPTR_0014s09410g [Populus trichocarpa] gi|566203388|ref|XP_002320199.2| hypothetical protein POPTR_0014s09410g [Populus trichocarpa] gi|550323831|gb|EEE98515.2| hypothetical protein POPTR_0014s09410g [Populus trichocarpa] gi|550323832|gb|EEE98514.2| hypothetical protein POPTR_0014s09410g [Populus trichocarpa] Length = 1889 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +3 Query: 3 PISLLSRPYGSQSFKVIYSRVVRGSDIPEQTTTLASEDSTVS 128 P+SLLSRPYGSQSFKVIY+RVVRGS+ P+ T+ A E T S Sbjct: 1846 PMSLLSRPYGSQSFKVIYNRVVRGSESPKSTSFAAGEGCTTS 1887 >ref|XP_006444841.1| hypothetical protein CICLE_v10018452mg [Citrus clementina] gi|567904708|ref|XP_006444842.1| hypothetical protein CICLE_v10018452mg [Citrus clementina] gi|567904710|ref|XP_006444843.1| hypothetical protein CICLE_v10018452mg [Citrus clementina] gi|567904712|ref|XP_006444844.1| hypothetical protein CICLE_v10018452mg [Citrus clementina] gi|567904714|ref|XP_006444845.1| hypothetical protein CICLE_v10018452mg [Citrus clementina] gi|567904716|ref|XP_006444846.1| hypothetical protein CICLE_v10018452mg [Citrus clementina] gi|568876411|ref|XP_006491272.1| PREDICTED: clustered mitochondria protein homolog isoform X1 [Citrus sinensis] gi|568876413|ref|XP_006491273.1| PREDICTED: clustered mitochondria protein homolog isoform X2 [Citrus sinensis] gi|568876415|ref|XP_006491274.1| PREDICTED: clustered mitochondria protein homolog isoform X3 [Citrus sinensis] gi|557547103|gb|ESR58081.1| hypothetical protein CICLE_v10018452mg [Citrus clementina] gi|557547104|gb|ESR58082.1| hypothetical protein CICLE_v10018452mg [Citrus clementina] gi|557547105|gb|ESR58083.1| hypothetical protein CICLE_v10018452mg [Citrus clementina] gi|557547106|gb|ESR58084.1| hypothetical protein CICLE_v10018452mg [Citrus clementina] gi|557547107|gb|ESR58085.1| hypothetical protein CICLE_v10018452mg [Citrus clementina] gi|557547108|gb|ESR58086.1| hypothetical protein CICLE_v10018452mg [Citrus clementina] Length = 1888 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = +3 Query: 3 PISLLSRPYGSQSFKVIYSRVVRGSDIPEQTTTLASEDSTVSTV 134 PISLLSRPYGSQSFKVIY+RV+RGS+ P+ + ++ DST + V Sbjct: 1845 PISLLSRPYGSQSFKVIYNRVIRGSEAPKSFSFSSTGDSTATAV 1888 >ref|XP_002523351.1| eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] gi|223537439|gb|EEF39067.1| eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] Length = 1872 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = +3 Query: 3 PISLLSRPYGSQSFKVIYSRVVRGSDIPEQTTTLASEDSTVS 128 PISLL+RPYGSQSFKVIY+RVVRGS+ P+ T +++D T S Sbjct: 1829 PISLLNRPYGSQSFKVIYNRVVRGSEAPKSTCFPSAKDCTAS 1870 >ref|XP_006386627.1| hypothetical protein POPTR_0002s17200g [Populus trichocarpa] gi|566158486|ref|XP_002301409.2| hypothetical protein POPTR_0002s17200g [Populus trichocarpa] gi|550345201|gb|ERP64424.1| hypothetical protein POPTR_0002s17200g [Populus trichocarpa] gi|550345202|gb|EEE80682.2| hypothetical protein POPTR_0002s17200g [Populus trichocarpa] Length = 1869 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +3 Query: 3 PISLLSRPYGSQSFKVIYSRVVRGSDIPEQTTTLASEDSTVS 128 PISLLSRPYGSQSFKVIY+RVVRGS+ P+ T+ E T S Sbjct: 1826 PISLLSRPYGSQSFKVIYNRVVRGSEPPKSTSFAPGEGCTAS 1867 >gb|EOX95712.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 3 [Theobroma cacao] Length = 1840 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +3 Query: 3 PISLLSRPYGSQSFKVIYSRVVRGSDIPEQTTTLASEDSTVS 128 PISLLSRPYGSQSFKVIY+RVVRGS+ P+ + +SE T + Sbjct: 1797 PISLLSRPYGSQSFKVIYNRVVRGSEAPKSSRFYSSESCTAT 1838 >gb|EOX95711.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 2 [Theobroma cacao] Length = 1872 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +3 Query: 3 PISLLSRPYGSQSFKVIYSRVVRGSDIPEQTTTLASEDSTVS 128 PISLLSRPYGSQSFKVIY+RVVRGS+ P+ + +SE T + Sbjct: 1829 PISLLSRPYGSQSFKVIYNRVVRGSEAPKSSRFYSSESCTAT 1870 >gb|EOX95710.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 1878 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +3 Query: 3 PISLLSRPYGSQSFKVIYSRVVRGSDIPEQTTTLASEDSTVS 128 PISLLSRPYGSQSFKVIY+RVVRGS+ P+ + +SE T + Sbjct: 1835 PISLLSRPYGSQSFKVIYNRVVRGSEAPKSSRFYSSESCTAT 1876 >ref|XP_002278370.2| PREDICTED: protein KIAA0664 homolog [Vitis vinifera] Length = 1863 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +3 Query: 3 PISLLSRPYGSQSFKVIYSRVVRGSDIPEQTTTLASEDSTVSTV 134 PISLL+RPYGSQSFKVIY+RVVRGS++P+ + E+S V Sbjct: 1820 PISLLNRPYGSQSFKVIYNRVVRGSEVPKSNSISLREESAAGAV 1863 >ref|XP_004157615.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101229361 [Cucumis sativus] Length = 1856 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +3 Query: 3 PISLLSRPYGSQSFKVIYSRVVRGSDIPEQTTTLASEDSTVS 128 PISLLSRPYGSQSFKV Y+RVVRGSD+ + T+ AS++ T S Sbjct: 1813 PISLLSRPYGSQSFKVNYNRVVRGSDLSKFTSYSASKECTAS 1854 >ref|XP_004140673.1| PREDICTED: uncharacterized protein LOC101210514 [Cucumis sativus] Length = 1856 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +3 Query: 3 PISLLSRPYGSQSFKVIYSRVVRGSDIPEQTTTLASEDSTVS 128 PISLLSRPYGSQSFKV Y+RVVRGSD+ + T+ AS++ T S Sbjct: 1813 PISLLSRPYGSQSFKVNYNRVVRGSDLSKFTSYSASKECTAS 1854 >ref|XP_006852659.1| hypothetical protein AMTR_s00021p00245460 [Amborella trichopoda] gi|548856270|gb|ERN14126.1| hypothetical protein AMTR_s00021p00245460 [Amborella trichopoda] Length = 1909 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +3 Query: 3 PISLLSRPYGSQSFKVIYSRVVRGSDIPEQTTTLASEDS 119 PISLL+RPYGSQSFKVIY+RVVRGS+ P+ T +S D+ Sbjct: 1861 PISLLNRPYGSQSFKVIYNRVVRGSEPPKPTHMTSSNDN 1899 >gb|EMJ21637.1| hypothetical protein PRUPE_ppa000096mg [Prunus persica] Length = 1835 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +3 Query: 3 PISLLSRPYGSQSFKVIYSRVVRGSDIPEQTTTLASEDSTVS 128 PISLLSRPYGSQSFKVI +RVVRGSD + T+ +SE+ T + Sbjct: 1792 PISLLSRPYGSQSFKVINNRVVRGSDATKATSFPSSENCTAT 1833