BLASTX nr result
ID: Stemona21_contig00024385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00024385 (813 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004977567.1| PREDICTED: uncharacterized protein LOC101780... 48 5e-07 tpg|DAA59259.1| TPA: hypothetical protein ZEAMMB73_975576 [Zea m... 46 1e-06 ref|NP_001140569.1| uncharacterized protein LOC100272635 [Zea ma... 46 1e-06 ref|XP_002441843.1| hypothetical protein SORBIDRAFT_08g003220 [S... 45 2e-06 ref|XP_003578900.1| PREDICTED: uncharacterized protein LOC100843... 43 8e-06 >ref|XP_004977567.1| PREDICTED: uncharacterized protein LOC101780875 [Setaria italica] Length = 390 Score = 48.1 bits (113), Expect(2) = 5e-07 Identities = 20/43 (46%), Positives = 28/43 (65%) Frame = -2 Query: 350 VSAKHPWLCSF*NPKSGHMFTLIDGWINTVLGGLLLGREPTVA 222 +S K PW+ P+ GHMF L+DGW + +L LL+G EP+ A Sbjct: 348 ISKKLPWIKYHEVPEGGHMFMLVDGWTDRILKALLVGEEPSAA 390 Score = 32.7 bits (73), Expect(2) = 5e-07 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -1 Query: 507 QDKVRQHGDYEFLHRILMVVLFDAEFDRMHMSGP-PYKSGT 388 ++K RQ G YE +HR L+V +FD M+ + P P G+ Sbjct: 288 ENKSRQQGTYESIHRDLLVAFGSWDFDPMNSTNPFPQNEGS 328 >tpg|DAA59259.1| TPA: hypothetical protein ZEAMMB73_975576 [Zea mays] Length = 392 Score = 45.8 bits (107), Expect(2) = 1e-06 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = -2 Query: 350 VSAKHPWLCSF*NPKSGHMFTLIDGWINTVLGGLLLGREP 231 ++ K PW+ P+ GHMF ++DGW + +L LLLG EP Sbjct: 350 IAKKLPWIKYHEVPEGGHMFVMVDGWTDRILKALLLGEEP 389 Score = 33.5 bits (75), Expect(2) = 1e-06 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 507 QDKVRQHGDYEFLHRILMVVLFDAEFDRMHMSGP-PYKSGT 388 ++K RQ G YE +HR L+V EFD M+++ P P G+ Sbjct: 290 ENKSRQQGIYESIHRDLLVAFGTWEFDPMNVTNPFPQNEGS 330 >ref|NP_001140569.1| uncharacterized protein LOC100272635 [Zea mays] gi|194700020|gb|ACF84094.1| unknown [Zea mays] Length = 385 Score = 45.8 bits (107), Expect(2) = 1e-06 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = -2 Query: 350 VSAKHPWLCSF*NPKSGHMFTLIDGWINTVLGGLLLGREP 231 ++ K PW+ P+ GHMF ++DGW + +L LLLG EP Sbjct: 343 IAKKLPWIKYHEVPEGGHMFVMVDGWTDRILKALLLGEEP 382 Score = 33.5 bits (75), Expect(2) = 1e-06 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 507 QDKVRQHGDYEFLHRILMVVLFDAEFDRMHMSGP-PYKSGT 388 ++K RQ G YE +HR L+V EFD M+++ P P G+ Sbjct: 283 ENKSRQQGIYESIHRDLLVAFGTWEFDPMNVTNPFPQNEGS 323 >ref|XP_002441843.1| hypothetical protein SORBIDRAFT_08g003220 [Sorghum bicolor] gi|241942536|gb|EES15681.1| hypothetical protein SORBIDRAFT_08g003220 [Sorghum bicolor] Length = 347 Score = 44.7 bits (104), Expect(2) = 2e-06 Identities = 19/39 (48%), Positives = 25/39 (64%) Frame = -2 Query: 350 VSAKHPWLCSF*NPKSGHMFTLIDGWINTVLGGLLLGRE 234 +S K PW+ P+ GHMF L+DGW + +L LLLG E Sbjct: 305 ISKKLPWIKYHEVPEGGHMFMLVDGWTDRILKALLLGEE 343 Score = 33.9 bits (76), Expect(2) = 2e-06 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 507 QDKVRQHGDYEFLHRILMVVLFDAEFDRMHMSGP-PYKSGT 388 ++K RQ G YE +HR L+V EFD M+++ P P G+ Sbjct: 245 ENKSRQQGIYESIHRDLLVAFGSWEFDPMNITNPFPQNEGS 285 >ref|XP_003578900.1| PREDICTED: uncharacterized protein LOC100843916 [Brachypodium distachyon] Length = 347 Score = 42.7 bits (99), Expect(2) = 8e-06 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = -2 Query: 350 VSAKHPWLCSF*NPKSGHMFTLIDGWINTVLGGLLLGRE 234 +S K PW+ P+ GHMF L+DGW + ++ LL+G E Sbjct: 305 ISKKLPWIQYHEVPEGGHMFMLVDGWTDKIIKALLVGEE 343 Score = 33.9 bits (76), Expect(2) = 8e-06 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = -1 Query: 507 QDKVRQHGDYEFLHRILMVVLFDAEFDRMHMSGP 406 ++K RQ G YE +HR L+V + EFD M+++ P Sbjct: 245 ENKSRQQGIYESIHRDLLVAFGNWEFDPMNITNP 278