BLASTX nr result
ID: Stemona21_contig00024068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00024068 (262 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004168881.1| PREDICTED: uncharacterized LOC101216257, par... 65 9e-09 ref|XP_004147194.1| PREDICTED: uncharacterized protein LOC101216... 64 2e-08 ref|XP_006845532.1| hypothetical protein AMTR_s00019p00173770 [A... 61 1e-07 ref|XP_002312619.2| hypothetical protein POPTR_0008s17490g [Popu... 61 2e-07 ref|XP_002518189.1| conserved hypothetical protein [Ricinus comm... 59 7e-07 ref|XP_004296528.1| PREDICTED: uncharacterized protein LOC101305... 58 1e-06 ref|XP_002282738.1| PREDICTED: uncharacterized protein LOC100251... 58 1e-06 gb|EXB54781.1| hypothetical protein L484_019912 [Morus notabilis] 58 2e-06 ref|XP_006367316.1| PREDICTED: dentin sialophosphoprotein-like [... 57 2e-06 ref|XP_006340905.1| PREDICTED: dentin sialophosphoprotein-like i... 57 3e-06 ref|XP_006340904.1| PREDICTED: dentin sialophosphoprotein-like i... 57 3e-06 gb|EOY05461.1| BLISTER-like protein [Theobroma cacao] 57 3e-06 gb|EMJ27475.1| hypothetical protein PRUPE_ppa019473mg [Prunus pe... 57 3e-06 ref|XP_004497763.1| PREDICTED: serine-rich adhesin for platelets... 56 4e-06 ref|XP_004253174.1| PREDICTED: uncharacterized protein LOC101265... 55 8e-06 ref|XP_004247805.1| PREDICTED: uncharacterized protein LOC101249... 55 1e-05 >ref|XP_004168881.1| PREDICTED: uncharacterized LOC101216257, partial [Cucumis sativus] Length = 507 Score = 65.1 bits (157), Expect = 9e-09 Identities = 35/69 (50%), Positives = 48/69 (69%), Gaps = 3/69 (4%) Frame = -3 Query: 203 FNSDKLPLNSSVSLNDELVN---AFEIKDYDSQRNHDMIVVKKDEDFAALEQHIEDLTQE 33 F +D+ + S++L L++ I+D +R H++ K++EDFAALEQHIEDLTQE Sbjct: 416 FRTDERDGSESLTLQKPLMDDQPIIGIEDNTMERKHELYSSKQNEDFAALEQHIEDLTQE 475 Query: 32 KFSLQRALD 6 KFSLQRALD Sbjct: 476 KFSLQRALD 484 >ref|XP_004147194.1| PREDICTED: uncharacterized protein LOC101216257 [Cucumis sativus] Length = 607 Score = 63.9 bits (154), Expect = 2e-08 Identities = 36/75 (48%), Positives = 46/75 (61%), Gaps = 5/75 (6%) Frame = -3 Query: 215 TQQDFNSDKLPLNSSVSLNDELVNAFE-----IKDYDSQRNHDMIVVKKDEDFAALEQHI 51 T F S P++ S S + + I+D +R H++ K++EDFAALEQHI Sbjct: 422 TPSHFTSQNTPVSYSNSFPPSVFPVKDQPIIGIEDNTMERKHELYSSKQNEDFAALEQHI 481 Query: 50 EDLTQEKFSLQRALD 6 EDLTQEKFSLQRALD Sbjct: 482 EDLTQEKFSLQRALD 496 >ref|XP_006845532.1| hypothetical protein AMTR_s00019p00173770 [Amborella trichopoda] gi|548848104|gb|ERN07207.1| hypothetical protein AMTR_s00019p00173770 [Amborella trichopoda] Length = 793 Score = 61.2 bits (147), Expect = 1e-07 Identities = 39/69 (56%), Positives = 48/69 (69%), Gaps = 1/69 (1%) Frame = -3 Query: 209 QDFNSDKLPLNS-SVSLNDELVNAFEIKDYDSQRNHDMIVVKKDEDFAALEQHIEDLTQE 33 Q N L ++S S+S + E + IKD +S R + + KK+EDFAALEQHIEDLTQE Sbjct: 389 QSMNDHSLSVSSHSISHDIESLRQL-IKDENSLRQFENLS-KKNEDFAALEQHIEDLTQE 446 Query: 32 KFSLQRALD 6 KFSLQRALD Sbjct: 447 KFSLQRALD 455 >ref|XP_002312619.2| hypothetical protein POPTR_0008s17490g [Populus trichocarpa] gi|550333299|gb|EEE89986.2| hypothetical protein POPTR_0008s17490g [Populus trichocarpa] Length = 667 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/56 (57%), Positives = 41/56 (73%) Frame = -3 Query: 173 SVSLNDELVNAFEIKDYDSQRNHDMIVVKKDEDFAALEQHIEDLTQEKFSLQRALD 6 SVS + + NA E +RNH+ + K++EDF+ LEQHIEDLTQEKFSLQRAL+ Sbjct: 360 SVSSTNGVTNANE---NSMERNHEFYLPKQNEDFSGLEQHIEDLTQEKFSLQRALE 412 >ref|XP_002518189.1| conserved hypothetical protein [Ricinus communis] gi|223542785|gb|EEF44322.1| conserved hypothetical protein [Ricinus communis] Length = 713 Score = 58.9 bits (141), Expect = 7e-07 Identities = 33/61 (54%), Positives = 39/61 (63%) Frame = -3 Query: 185 PLNSSVSLNDELVNAFEIKDYDSQRNHDMIVVKKDEDFAALEQHIEDLTQEKFSLQRALD 6 P+ S S N V I + R H+ K +EDFAALEQHIEDLTQEKFSLQRAL+ Sbjct: 352 PMTFSASSNS--VEMSNIDENSWGRKHEFYSSKHNEDFAALEQHIEDLTQEKFSLQRALE 409 Query: 5 T 3 + Sbjct: 410 S 410 >ref|XP_004296528.1| PREDICTED: uncharacterized protein LOC101305650 [Fragaria vesca subsp. vesca] Length = 787 Score = 58.2 bits (139), Expect = 1e-06 Identities = 34/73 (46%), Positives = 47/73 (64%), Gaps = 1/73 (1%) Frame = -3 Query: 221 PSTQQDF-NSDKLPLNSSVSLNDELVNAFEIKDYDSQRNHDMIVVKKDEDFAALEQHIED 45 P+ F +S+K L SS ++ + I + + R H+ K+++DFAALEQHIED Sbjct: 396 PAAPHSFEHSNKSSLFSSAGVDQQR----PIVESNLDRKHEFYSSKQNDDFAALEQHIED 451 Query: 44 LTQEKFSLQRALD 6 LTQEKFSLQRAL+ Sbjct: 452 LTQEKFSLQRALE 464 >ref|XP_002282738.1| PREDICTED: uncharacterized protein LOC100251145 [Vitis vinifera] gi|297741880|emb|CBI33315.3| unnamed protein product [Vitis vinifera] Length = 804 Score = 58.2 bits (139), Expect = 1e-06 Identities = 33/60 (55%), Positives = 43/60 (71%), Gaps = 1/60 (1%) Frame = -3 Query: 182 LNSSVSLNDELVNAFEIKDYDS-QRNHDMIVVKKDEDFAALEQHIEDLTQEKFSLQRALD 6 +NSSVS+ + + D +S +R + K++EDFAALEQHIEDLTQEKFSLQRAL+ Sbjct: 410 INSSVSVGNRVEMLRHGLDQNSLERKFEFHSQKQNEDFAALEQHIEDLTQEKFSLQRALE 469 >gb|EXB54781.1| hypothetical protein L484_019912 [Morus notabilis] Length = 886 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/71 (43%), Positives = 47/71 (66%) Frame = -3 Query: 218 STQQDFNSDKLPLNSSVSLNDELVNAFEIKDYDSQRNHDMIVVKKDEDFAALEQHIEDLT 39 ST Q F+ ++ S++ + ++ + + + H+ + K++EDFAALEQHIEDLT Sbjct: 415 STSQAFDPSINSVSDSIAGDQPKLS---VNENGMEWKHEFYLPKQNEDFAALEQHIEDLT 471 Query: 38 QEKFSLQRALD 6 QEKFSLQRAL+ Sbjct: 472 QEKFSLQRALE 482 >ref|XP_006367316.1| PREDICTED: dentin sialophosphoprotein-like [Solanum tuberosum] Length = 789 Score = 57.4 bits (137), Expect = 2e-06 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 2/79 (2%) Frame = -3 Query: 236 EIHPLPSTQQDFNSDKLPLNS--SVSLNDELVNAFEIKDYDSQRNHDMIVVKKDEDFAAL 63 ++HP+ T + NS + +S S S +D+L + E + + K++EDFAAL Sbjct: 383 KVHPM-DTLESSNSRNMMNSSTFSASGSDQLNHHAEKDTGNMDNRYQSFAQKQNEDFAAL 441 Query: 62 EQHIEDLTQEKFSLQRALD 6 EQHIEDLTQEKFS QRAL+ Sbjct: 442 EQHIEDLTQEKFSSQRALE 460 >ref|XP_006340905.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Solanum tuberosum] Length = 789 Score = 57.0 bits (136), Expect = 3e-06 Identities = 35/67 (52%), Positives = 42/67 (62%), Gaps = 2/67 (2%) Frame = -3 Query: 200 NSDKLPLNSSVSLN--DELVNAFEIKDYDSQRNHDMIVVKKDEDFAALEQHIEDLTQEKF 27 NS+ L +S S N D +A E + H K++EDFAALEQHIEDLTQEKF Sbjct: 389 NSENLTNSSKFSGNGSDLYKHAVEKDMGNLDNRHPFYSQKQNEDFAALEQHIEDLTQEKF 448 Query: 26 SLQRALD 6 SLQRAL+ Sbjct: 449 SLQRALE 455 >ref|XP_006340904.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Solanum tuberosum] Length = 790 Score = 57.0 bits (136), Expect = 3e-06 Identities = 35/67 (52%), Positives = 42/67 (62%), Gaps = 2/67 (2%) Frame = -3 Query: 200 NSDKLPLNSSVSLN--DELVNAFEIKDYDSQRNHDMIVVKKDEDFAALEQHIEDLTQEKF 27 NS+ L +S S N D +A E + H K++EDFAALEQHIEDLTQEKF Sbjct: 390 NSENLTNSSKFSGNGSDLYKHAVEKDMGNLDNRHPFYSQKQNEDFAALEQHIEDLTQEKF 449 Query: 26 SLQRALD 6 SLQRAL+ Sbjct: 450 SLQRALE 456 >gb|EOY05461.1| BLISTER-like protein [Theobroma cacao] Length = 755 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 113 RNHDMIVVKKDEDFAALEQHIEDLTQEKFSLQRALD 6 + H+ K++EDFAALEQHIEDLTQEKFSLQRAL+ Sbjct: 395 KKHEFYSTKQNEDFAALEQHIEDLTQEKFSLQRALE 430 >gb|EMJ27475.1| hypothetical protein PRUPE_ppa019473mg [Prunus persica] Length = 580 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -3 Query: 134 IKDYDSQRNHDMIVVKKDEDFAALEQHIEDLTQEKFSLQRALD 6 I+ +R H+ ++EDF+ALEQHIEDLTQEKFSLQRALD Sbjct: 430 IEGNSMERKHEFYSPNQNEDFSALEQHIEDLTQEKFSLQRALD 472 >ref|XP_004497763.1| PREDICTED: serine-rich adhesin for platelets-like [Cicer arietinum] Length = 783 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -3 Query: 131 KDYDSQRNHDMIVVKKDEDFAALEQHIEDLTQEKFSLQRALD 6 K+ ++ HD ++EDF+ALEQHIEDLTQEKFSLQRAL+ Sbjct: 401 KENGMEKKHDYYSSSQNEDFSALEQHIEDLTQEKFSLQRALE 442 >ref|XP_004253174.1| PREDICTED: uncharacterized protein LOC101265716 [Solanum lycopersicum] Length = 787 Score = 55.5 bits (132), Expect = 8e-06 Identities = 35/77 (45%), Positives = 46/77 (59%), Gaps = 2/77 (2%) Frame = -3 Query: 230 HPLPSTQQDFNSDKLPLNS--SVSLNDELVNAFEIKDYDSQRNHDMIVVKKDEDFAALEQ 57 HP T + NS + +S S S +D+L + E + + K++EDFAALEQ Sbjct: 385 HPT-DTLESSNSRNMMTSSTFSASGSDQLNHHAEKDTGNMDNRYQSFAQKQNEDFAALEQ 443 Query: 56 HIEDLTQEKFSLQRALD 6 HIEDLTQEKFS QRAL+ Sbjct: 444 HIEDLTQEKFSSQRALE 460 >ref|XP_004247805.1| PREDICTED: uncharacterized protein LOC101249494 [Solanum lycopersicum] Length = 789 Score = 55.1 bits (131), Expect = 1e-05 Identities = 35/73 (47%), Positives = 42/73 (57%), Gaps = 10/73 (13%) Frame = -3 Query: 194 DKLPLNSSVSLNDELVN----------AFEIKDYDSQRNHDMIVVKKDEDFAALEQHIED 45 D L L+SS +L + N A E + H K++EDFAALEQHIED Sbjct: 383 DTLGLSSSENLTNSSKNSGNGTVLYKHAVEKDMGNLDNRHPFYSQKQNEDFAALEQHIED 442 Query: 44 LTQEKFSLQRALD 6 LTQEKFSLQRAL+ Sbjct: 443 LTQEKFSLQRALE 455