BLASTX nr result
ID: Stemona21_contig00023673
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00023673 (629 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX95485.1| Ubiquinone biosynthesis protein coq-8 [Theobroma ... 58 2e-06 ref|XP_002515159.1| Ubiquinone biosynthesis protein coq-8, putat... 58 2e-06 >gb|EOX95485.1| Ubiquinone biosynthesis protein coq-8 [Theobroma cacao] Length = 615 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/56 (53%), Positives = 40/56 (71%) Frame = -1 Query: 449 SQVAEAASAGGFEAVVAGALKRAVVAATDLVGLTKGRPREVSAPRRPRESVVFFHT 282 SQ E A G E ++A ++K AVV+A DL GLTKG RE S+P RP+ESVV+F++ Sbjct: 25 SQTIENAKKGDLETLLASSIKNAVVSAADLAGLTKGTVREFSSP-RPKESVVYFNS 79 >ref|XP_002515159.1| Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis] gi|223545639|gb|EEF47143.1| Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis] Length = 620 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/64 (46%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Frame = -1 Query: 449 SQVAEAASAGGFEAVVAGALKRAVVAATDLVGLTKGRPREVSAPRRPRESVVFF-HTPVV 273 S+ +AA+ G F+ + K+A+V+ TDL GLTKG RE + P +P+ESVVFF H+ V Sbjct: 25 SKSLDAAATGDFQTLFTSTAKKAIVSVTDLSGLTKGNVREFTPP-KPKESVVFFDHSDDV 83 Query: 272 PDPA 261 P+P+ Sbjct: 84 PEPS 87