BLASTX nr result
ID: Stemona21_contig00023653
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00023653 (465 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY01819.1| DHHC-type zinc finger family protein isoform 2 [T... 55 7e-06 gb|EOY01818.1| DHHC-type zinc finger family protein isoform 1 [T... 55 7e-06 >gb|EOY01819.1| DHHC-type zinc finger family protein isoform 2 [Theobroma cacao] Length = 606 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = -3 Query: 427 AIVIFLALRFAFYVFFLPFVEGKPFEYVILGIYTP 323 A+ +FLAL FAFYVFF PFV K F+Y+++GIYTP Sbjct: 17 AVAVFLALGFAFYVFFAPFVGKKMFQYIVMGIYTP 51 >gb|EOY01818.1| DHHC-type zinc finger family protein isoform 1 [Theobroma cacao] Length = 627 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = -3 Query: 427 AIVIFLALRFAFYVFFLPFVEGKPFEYVILGIYTP 323 A+ +FLAL FAFYVFF PFV K F+Y+++GIYTP Sbjct: 17 AVAVFLALGFAFYVFFAPFVGKKMFQYIVMGIYTP 51