BLASTX nr result
ID: Stemona21_contig00022611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00022611 (414 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001146251.1| hypothetical protein precursor [Zea mays] gi... 55 1e-05 >ref|NP_001146251.1| hypothetical protein precursor [Zea mays] gi|219886393|gb|ACL53571.1| unknown [Zea mays] gi|414869969|tpg|DAA48526.1| TPA: hypothetical protein ZEAMMB73_975942 [Zea mays] Length = 384 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 413 RANRIIVRQFMTGPTEYMSPMNLSTILAMDARA 315 +ANRIIV QFM GP EYM P+NLSTILA+DARA Sbjct: 347 KANRIIVSQFMDGPQEYMHPLNLSTILAVDARA 379