BLASTX nr result
ID: Stemona21_contig00022122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00022122 (331 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ06730.1| hypothetical protein PRUPE_ppa008513mg [Prunus pe... 64 2e-08 gb|ESW18666.1| hypothetical protein PHAVU_006G059800g [Phaseolus... 64 2e-08 ref|XP_003551376.1| PREDICTED: BTB/POZ domain-containing protein... 64 2e-08 ref|XP_006305328.1| hypothetical protein CARUB_v10009707mg [Caps... 63 4e-08 ref|XP_006586164.1| PREDICTED: BTB/POZ domain-containing protein... 63 5e-08 ref|XP_003532194.1| PREDICTED: BTB/POZ domain-containing protein... 63 5e-08 ref|XP_003600432.1| Speckle-type POZ protein-like A [Medicago tr... 63 5e-08 gb|EXB51037.1| BTB/POZ domain-containing protein [Morus notabilis] 62 6e-08 ref|NP_175972.1| BTB/POZ domain-containing protein [Arabidopsis ... 62 6e-08 ref|XP_006392606.1| hypothetical protein EUTSA_v10011642mg [Eutr... 62 8e-08 ref|XP_004294912.1| PREDICTED: BTB/POZ domain-containing protein... 62 8e-08 ref|XP_004139768.1| PREDICTED: BTB/POZ domain-containing protein... 62 8e-08 ref|XP_006857648.1| hypothetical protein AMTR_s00061p00142810 [A... 62 1e-07 ref|XP_002276318.1| PREDICTED: BTB/POZ domain-containing protein... 62 1e-07 ref|XP_004500161.1| PREDICTED: BTB/POZ domain-containing protein... 61 1e-07 gb|AFK49561.1| unknown [Lotus japonicus] 61 1e-07 ref|XP_006495199.1| PREDICTED: BTB/POZ domain-containing protein... 60 4e-07 ref|XP_006452707.1| hypothetical protein CICLE_v10008898mg [Citr... 60 4e-07 ref|XP_006452706.1| hypothetical protein CICLE_v10008898mg [Citr... 60 4e-07 ref|XP_006452705.1| hypothetical protein CICLE_v10008898mg [Citr... 60 4e-07 >gb|EMJ06730.1| hypothetical protein PRUPE_ppa008513mg [Prunus persica] Length = 328 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -2 Query: 330 FGKIYEIRDEFNVFLLTADRDLIAEIFQEVLAAWKG 223 FGKIY+I+D+FN FLL+ADRDLIAEIF EVL AWKG Sbjct: 292 FGKIYDIQDDFNAFLLSADRDLIAEIFHEVLNAWKG 327 >gb|ESW18666.1| hypothetical protein PHAVU_006G059800g [Phaseolus vulgaris] Length = 328 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -2 Query: 330 FGKIYEIRDEFNVFLLTADRDLIAEIFQEVLAAWKG 223 FGKIYEIRD+FN FL ADRDLIAE+F EVL AWKG Sbjct: 292 FGKIYEIRDDFNTFLQNADRDLIAEVFHEVLDAWKG 327 >ref|XP_003551376.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Glycine max] Length = 328 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -2 Query: 330 FGKIYEIRDEFNVFLLTADRDLIAEIFQEVLAAWKG 223 FGKIYEIRD+FN FL ADRDLIAE+F EVL AWKG Sbjct: 292 FGKIYEIRDDFNTFLQNADRDLIAEVFHEVLDAWKG 327 >ref|XP_006305328.1| hypothetical protein CARUB_v10009707mg [Capsella rubella] gi|482574039|gb|EOA38226.1| hypothetical protein CARUB_v10009707mg [Capsella rubella] Length = 329 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 330 FGKIYEIRDEFNVFLLTADRDLIAEIFQEVLAAWKG 223 FGK++EIRDEFN+F+ ADRDLI+E+FQEVL WKG Sbjct: 293 FGKVFEIRDEFNIFMQCADRDLISEVFQEVLGTWKG 328 >ref|XP_006586164.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like isoform X2 [Glycine max] Length = 320 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -2 Query: 330 FGKIYEIRDEFNVFLLTADRDLIAEIFQEVLAAWKG 223 FGKIYEIRD+FN FL ADRDLI+E+F EVL AWKG Sbjct: 284 FGKIYEIRDDFNTFLRNADRDLISEVFHEVLDAWKG 319 >ref|XP_003532194.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like isoform X1 [Glycine max] Length = 328 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -2 Query: 330 FGKIYEIRDEFNVFLLTADRDLIAEIFQEVLAAWKG 223 FGKIYEIRD+FN FL ADRDLI+E+F EVL AWKG Sbjct: 292 FGKIYEIRDDFNTFLRNADRDLISEVFHEVLDAWKG 327 >ref|XP_003600432.1| Speckle-type POZ protein-like A [Medicago truncatula] gi|355489480|gb|AES70683.1| Speckle-type POZ protein-like A [Medicago truncatula] Length = 330 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 330 FGKIYEIRDEFNVFLLTADRDLIAEIFQEVLAAWKG 223 FGKI+EIRD+FN+FL ADRDLIAE+F EVL AWKG Sbjct: 294 FGKIFEIRDDFNLFLQNADRDLIAEVFGEVLGAWKG 329 >gb|EXB51037.1| BTB/POZ domain-containing protein [Morus notabilis] Length = 328 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -2 Query: 330 FGKIYEIRDEFNVFLLTADRDLIAEIFQEVLAAWKG 223 FGKI++IR++FN FLL+ADR+LIAEIF EVL+AWKG Sbjct: 292 FGKIFDIREDFNAFLLSADRELIAEIFHEVLSAWKG 327 >ref|NP_175972.1| BTB/POZ domain-containing protein [Arabidopsis thaliana] gi|75271590|sp|Q680K8.1|Y1576_ARATH RecName: Full=BTB/POZ domain-containing protein At1g55760 gi|51969392|dbj|BAD43388.1| unknown protein [Arabidopsis thaliana] gi|51969860|dbj|BAD43622.1| unknown protein [Arabidopsis thaliana] gi|63147370|gb|AAY34158.1| At1g55760 [Arabidopsis thaliana] gi|332195173|gb|AEE33294.1| BTB/POZ domain-containing protein [Arabidopsis thaliana] Length = 329 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -2 Query: 330 FGKIYEIRDEFNVFLLTADRDLIAEIFQEVLAAWKG 223 FGKI+EIRDEFN+F+ ADRDLI+EIF EVL+ WKG Sbjct: 293 FGKIFEIRDEFNIFMQCADRDLISEIFHEVLSTWKG 328 >ref|XP_006392606.1| hypothetical protein EUTSA_v10011642mg [Eutrema salsugineum] gi|557089184|gb|ESQ29892.1| hypothetical protein EUTSA_v10011642mg [Eutrema salsugineum] Length = 329 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 330 FGKIYEIRDEFNVFLLTADRDLIAEIFQEVLAAWKG 223 FGKI+EIRDEFN+F+ ADRDLI+E+F EVL+ WKG Sbjct: 293 FGKIFEIRDEFNIFMQCADRDLISEVFHEVLSTWKG 328 >ref|XP_004294912.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Fragaria vesca subsp. vesca] Length = 328 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 330 FGKIYEIRDEFNVFLLTADRDLIAEIFQEVLAAWKG 223 FGKI++IRD+FN FLL ADR+LIAEIF EVL AWKG Sbjct: 292 FGKIFDIRDDFNAFLLCADRELIAEIFHEVLNAWKG 327 >ref|XP_004139768.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Cucumis sativus] gi|449529700|ref|XP_004171836.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Cucumis sativus] Length = 327 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -2 Query: 330 FGKIYEIRDEFNVFLLTADRDLIAEIFQEVLAAWKG 223 FGKI +IRDEFN+FL ADRDLIAEIF E+L AWKG Sbjct: 291 FGKILDIRDEFNIFLQNADRDLIAEIFHEILNAWKG 326 >ref|XP_006857648.1| hypothetical protein AMTR_s00061p00142810 [Amborella trichopoda] gi|548861744|gb|ERN19115.1| hypothetical protein AMTR_s00061p00142810 [Amborella trichopoda] Length = 331 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = -2 Query: 330 FGKIYEIRDEFNVFLLTADRDLIAEIFQEVLAAWKG 223 FGKI++IRD+FN F+L ADR+LIA++FQEVL AWKG Sbjct: 295 FGKIFDIRDDFNAFMLIADRELIADVFQEVLNAWKG 330 >ref|XP_002276318.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Vitis vinifera] Length = 328 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -2 Query: 330 FGKIYEIRDEFNVFLLTADRDLIAEIFQEVLAAWKG 223 FGKI++IRD+FN FL ADRDLIAE+F EVL AWKG Sbjct: 292 FGKIFDIRDDFNAFLQCADRDLIAEVFHEVLTAWKG 327 >ref|XP_004500161.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Cicer arietinum] Length = 330 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -2 Query: 330 FGKIYEIRDEFNVFLLTADRDLIAEIFQEVLAAWKG 223 FGKI+EIRD+F+ FL ADRDLIAE+F EVL AWKG Sbjct: 294 FGKIFEIRDDFSTFLQNADRDLIAEVFHEVLGAWKG 329 >gb|AFK49561.1| unknown [Lotus japonicus] Length = 328 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -2 Query: 330 FGKIYEIRDEFNVFLLTADRDLIAEIFQEVLAAWKG 223 FGKIYEI+D+FN FL ADRDLI+E+F EVL AWKG Sbjct: 292 FGKIYEIKDDFNTFLQNADRDLISEVFYEVLDAWKG 327 >ref|XP_006495199.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Citrus sinensis] Length = 399 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 330 FGKIYEIRDEFNVFLLTADRDLIAEIFQEVLAAWKG 223 FGKI++IRD+F+VFL ADR+LIAE+F EVL AWKG Sbjct: 363 FGKIFDIRDDFSVFLQCADRELIAEVFHEVLGAWKG 398 >ref|XP_006452707.1| hypothetical protein CICLE_v10008898mg [Citrus clementina] gi|568841705|ref|XP_006474798.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Citrus sinensis] gi|557555933|gb|ESR65947.1| hypothetical protein CICLE_v10008898mg [Citrus clementina] Length = 328 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 330 FGKIYEIRDEFNVFLLTADRDLIAEIFQEVLAAWKG 223 FGKI++IRD+F+VFL ADR+LIAE+F EVL AWKG Sbjct: 292 FGKIFDIRDDFSVFLQCADRELIAEVFHEVLGAWKG 327 >ref|XP_006452706.1| hypothetical protein CICLE_v10008898mg [Citrus clementina] gi|557555932|gb|ESR65946.1| hypothetical protein CICLE_v10008898mg [Citrus clementina] Length = 280 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 330 FGKIYEIRDEFNVFLLTADRDLIAEIFQEVLAAWKG 223 FGKI++IRD+F+VFL ADR+LIAE+F EVL AWKG Sbjct: 244 FGKIFDIRDDFSVFLQCADRELIAEVFHEVLGAWKG 279 >ref|XP_006452705.1| hypothetical protein CICLE_v10008898mg [Citrus clementina] gi|557555931|gb|ESR65945.1| hypothetical protein CICLE_v10008898mg [Citrus clementina] Length = 263 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 330 FGKIYEIRDEFNVFLLTADRDLIAEIFQEVLAAWKG 223 FGKI++IRD+F+VFL ADR+LIAE+F EVL AWKG Sbjct: 227 FGKIFDIRDDFSVFLQCADRELIAEVFHEVLGAWKG 262