BLASTX nr result
ID: Stemona21_contig00021353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00021353 (340 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69116.1| hypothetical protein VITISV_031843 [Vitis vinifera] 48 1e-06 ref|XP_002284795.1| PREDICTED: F-box protein SKIP23-like [Vitis ... 47 2e-06 >emb|CAN69116.1| hypothetical protein VITISV_031843 [Vitis vinifera] Length = 389 Score = 47.8 bits (112), Expect(2) = 1e-06 Identities = 23/48 (47%), Positives = 33/48 (68%) Frame = +2 Query: 62 YEVVVLMNNHNQWVEVKNLGDQALFLGLSYSISLSVLEFPELKENCIY 205 ++V L + +W V +LGD+ALFLG + S+SLS ++FP K NCIY Sbjct: 290 FQVCRLDSKAPRWEVVSSLGDRALFLGENLSLSLSSVDFPGCKGNCIY 337 Score = 30.4 bits (67), Expect(2) = 1e-06 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +3 Query: 222 VYSLESGTTNLELLEPYRYKLNWPLPTWITPH 317 +++LE G+ +E L +++ WP P W+TP+ Sbjct: 358 IFNLEDGS--IEPLPCSHFRIRWPPPLWVTPN 387 >ref|XP_002284795.1| PREDICTED: F-box protein SKIP23-like [Vitis vinifera] Length = 389 Score = 46.6 bits (109), Expect(2) = 2e-06 Identities = 21/37 (56%), Positives = 28/37 (75%) Frame = +2 Query: 95 QWVEVKNLGDQALFLGLSYSISLSVLEFPELKENCIY 205 +W V +LGD+ALFLG + S+SLS ++FP K NCIY Sbjct: 301 RWEVVSSLGDRALFLGENLSLSLSSVDFPGCKGNCIY 337 Score = 30.4 bits (67), Expect(2) = 2e-06 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +3 Query: 222 VYSLESGTTNLELLEPYRYKLNWPLPTWITPH 317 +++LE G+ +E L +++ WP P W+TP+ Sbjct: 358 IFNLEDGS--IEPLPCSHFRIRWPPPLWVTPN 387