BLASTX nr result
ID: Stemona21_contig00020913
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00020913 (344 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT11945.1| hypothetical protein F775_08463 [Aegilops tauschii] 64 2e-08 dbj|BAK00590.1| predicted protein [Hordeum vulgare subsp. vulgare] 64 2e-08 dbj|BAJ85588.1| predicted protein [Hordeum vulgare subsp. vulgar... 64 2e-08 emb|CBH32598.1| 50S ribosomal protein L15, putative, expressed [... 64 2e-08 tpg|DAA54310.1| TPA: hypothetical protein ZEAMMB73_703096 [Zea m... 64 2e-08 ref|NP_001130590.1| uncharacterized protein LOC100191689 [Zea ma... 64 2e-08 ref|XP_006659305.1| PREDICTED: 54S ribosomal protein L10, mitoch... 64 3e-08 gb|EMS63730.1| hypothetical protein TRIUR3_10050 [Triticum urartu] 64 3e-08 ref|NP_001061512.1| Os08g0310100 [Oryza sativa Japonica Group] g... 64 3e-08 ref|XP_002455499.1| hypothetical protein SORBIDRAFT_03g012270 [S... 64 3e-08 ref|XP_004967590.1| PREDICTED: 54S ribosomal protein L10, mitoch... 62 8e-08 ref|XP_003573689.1| PREDICTED: 50S ribosomal protein L15-like [B... 61 2e-07 ref|XP_002268646.1| PREDICTED: 50S ribosomal protein L15 [Vitis ... 61 2e-07 gb|EXC59637.1| hypothetical protein L484_000306 [Morus notabilis] 60 2e-07 gb|EXB76038.1| 50S ribosomal protein L15 [Morus notabilis] 60 2e-07 ref|XP_004294530.1| PREDICTED: 50S ribosomal protein L15-like [F... 59 5e-07 gb|EMJ02494.1| hypothetical protein PRUPE_ppa008724mg [Prunus pe... 59 5e-07 gb|EMJ13454.1| hypothetical protein PRUPE_ppa013678mg [Prunus pe... 59 7e-07 ref|XP_004142813.1| PREDICTED: 50S ribosomal protein L15-like [C... 59 7e-07 ref|XP_006598141.1| PREDICTED: 54S ribosomal protein L10, mitoch... 58 1e-06 >gb|EMT11945.1| hypothetical protein F775_08463 [Aegilops tauschii] Length = 98 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -3 Query: 342 RPPPKQRDKVDSIGRLPAPTKPIPFTAEEMD 250 RPPPKQRDKVDSIGRLPAPTKP+PFT+EE++ Sbjct: 55 RPPPKQRDKVDSIGRLPAPTKPLPFTSEELE 85 >dbj|BAK00590.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 290 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -3 Query: 342 RPPPKQRDKVDSIGRLPAPTKPIPFTAEEMD 250 RPPPKQRDKVDSIGRLPAPTKP+PFT+EE++ Sbjct: 247 RPPPKQRDKVDSIGRLPAPTKPLPFTSEELE 277 >dbj|BAJ85588.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326505688|dbj|BAJ95515.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 290 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -3 Query: 342 RPPPKQRDKVDSIGRLPAPTKPIPFTAEEMD 250 RPPPKQRDKVDSIGRLPAPTKP+PFT+EE++ Sbjct: 247 RPPPKQRDKVDSIGRLPAPTKPLPFTSEELE 277 >emb|CBH32598.1| 50S ribosomal protein L15, putative, expressed [Triticum aestivum] Length = 297 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -3 Query: 342 RPPPKQRDKVDSIGRLPAPTKPIPFTAEEMD 250 RPPPKQRDKVDSIGRLPAPTKP+PFT+EE++ Sbjct: 254 RPPPKQRDKVDSIGRLPAPTKPLPFTSEELE 284 >tpg|DAA54310.1| TPA: hypothetical protein ZEAMMB73_703096 [Zea mays] Length = 304 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 342 RPPPKQRDKVDSIGRLPAPTKPIPFTAEEMD 250 RPPPKQRDKVDSIGRLPAPTKP+PFT EE++ Sbjct: 262 RPPPKQRDKVDSIGRLPAPTKPLPFTVEELE 292 >ref|NP_001130590.1| uncharacterized protein LOC100191689 [Zea mays] gi|194689570|gb|ACF78869.1| unknown [Zea mays] Length = 127 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 342 RPPPKQRDKVDSIGRLPAPTKPIPFTAEEMD 250 RPPPKQRDKVDSIGRLPAPTKP+PFT EE++ Sbjct: 85 RPPPKQRDKVDSIGRLPAPTKPLPFTVEELE 115 >ref|XP_006659305.1| PREDICTED: 54S ribosomal protein L10, mitochondrial-like [Oryza brachyantha] Length = 289 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 342 RPPPKQRDKVDSIGRLPAPTKPIPFTAEEMD 250 RPPPKQRDKVDSIGRLPAPTKP+PFT EE++ Sbjct: 247 RPPPKQRDKVDSIGRLPAPTKPLPFTPEELE 277 >gb|EMS63730.1| hypothetical protein TRIUR3_10050 [Triticum urartu] Length = 110 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 342 RPPPKQRDKVDSIGRLPAPTKPIPFTAEEMD 250 RPPPKQRDKVDSIGRLPAPTKP+PFT EE++ Sbjct: 67 RPPPKQRDKVDSIGRLPAPTKPLPFTPEELE 97 >ref|NP_001061512.1| Os08g0310100 [Oryza sativa Japonica Group] gi|34015188|gb|AAQ56383.1| putative ribosomal protein L15 [Oryza sativa Japonica Group] gi|50508079|dbj|BAD32079.1| putative LSU ribosomal protein L15P [Oryza sativa Japonica Group] gi|113623481|dbj|BAF23426.1| Os08g0310100 [Oryza sativa Japonica Group] gi|215707110|dbj|BAG93570.1| unnamed protein product [Oryza sativa Japonica Group] gi|218200689|gb|EEC83116.1| hypothetical protein OsI_28275 [Oryza sativa Indica Group] gi|222640117|gb|EEE68249.1| hypothetical protein OsJ_26453 [Oryza sativa Japonica Group] gi|258644556|dbj|BAI39809.1| putative LSU ribosomal protein L15P [Oryza sativa Indica Group] Length = 295 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 342 RPPPKQRDKVDSIGRLPAPTKPIPFTAEEMD 250 RPPPKQRDKVDSIGRLPAPTKP+PFT EE++ Sbjct: 253 RPPPKQRDKVDSIGRLPAPTKPLPFTPEELE 283 >ref|XP_002455499.1| hypothetical protein SORBIDRAFT_03g012270 [Sorghum bicolor] gi|241927474|gb|EES00619.1| hypothetical protein SORBIDRAFT_03g012270 [Sorghum bicolor] Length = 292 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 342 RPPPKQRDKVDSIGRLPAPTKPIPFTAEEMD 250 RPPPKQRDKVDSIGRLPAPTKP+PFT EE++ Sbjct: 248 RPPPKQRDKVDSIGRLPAPTKPLPFTPEELE 278 >ref|XP_004967590.1| PREDICTED: 54S ribosomal protein L10, mitochondrial-like [Setaria italica] Length = 297 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 342 RPPPKQRDKVDSIGRLPAPTKPIPFTAEEMD 250 RPPPKQ+DKVDSIGRLPAPTKP+PFT EE++ Sbjct: 253 RPPPKQQDKVDSIGRLPAPTKPLPFTPEELE 283 >ref|XP_003573689.1| PREDICTED: 50S ribosomal protein L15-like [Brachypodium distachyon] Length = 297 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 342 RPPPKQRDKVDSIGRLPAPTKPIPFTAEEMD 250 RPPPKQRD+ DSIGRLPAPTKP+PFT EE++ Sbjct: 254 RPPPKQRDRTDSIGRLPAPTKPLPFTQEELE 284 >ref|XP_002268646.1| PREDICTED: 50S ribosomal protein L15 [Vitis vinifera] gi|296085970|emb|CBI31411.3| unnamed protein product [Vitis vinifera] Length = 283 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 342 RPPPKQRDKVDSIGRLPAPTKPIPFTAEEMD 250 RPPPKQRDKVDSIGRLPAPTKPIPF EE + Sbjct: 246 RPPPKQRDKVDSIGRLPAPTKPIPFLPEEKE 276 >gb|EXC59637.1| hypothetical protein L484_000306 [Morus notabilis] Length = 102 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 342 RPPPKQRDKVDSIGRLPAPTKPIPFTAEEMD 250 RPPPKQRDKVDSIGRLPAPTKPIPF EE + Sbjct: 65 RPPPKQRDKVDSIGRLPAPTKPIPFFIEEKE 95 >gb|EXB76038.1| 50S ribosomal protein L15 [Morus notabilis] Length = 279 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 342 RPPPKQRDKVDSIGRLPAPTKPIPFTAEEMD 250 RPPPKQRDKVDSIGRLPAPTKPIPF EE + Sbjct: 242 RPPPKQRDKVDSIGRLPAPTKPIPFFIEEKE 272 >ref|XP_004294530.1| PREDICTED: 50S ribosomal protein L15-like [Fragaria vesca subsp. vesca] Length = 285 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 342 RPPPKQRDKVDSIGRLPAPTKPIPFTAEE 256 RPPPKQ+DKVDSIGRLPAPTKPIPF EE Sbjct: 248 RPPPKQKDKVDSIGRLPAPTKPIPFFTEE 276 >gb|EMJ02494.1| hypothetical protein PRUPE_ppa008724mg [Prunus persica] Length = 321 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 342 RPPPKQRDKVDSIGRLPAPTKPIPFTAEE 256 RPPPKQ+DKVDSIGRLPAPTKPIPF EE Sbjct: 285 RPPPKQKDKVDSIGRLPAPTKPIPFFTEE 313 >gb|EMJ13454.1| hypothetical protein PRUPE_ppa013678mg [Prunus persica] Length = 109 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 342 RPPPKQRDKVDSIGRLPAPTKPIPFTAEE 256 RPPPKQ+DKVDSIGRLPAPTKP+PF EE Sbjct: 73 RPPPKQKDKVDSIGRLPAPTKPVPFFTEE 101 >ref|XP_004142813.1| PREDICTED: 50S ribosomal protein L15-like [Cucumis sativus] gi|449520247|ref|XP_004167145.1| PREDICTED: 50S ribosomal protein L15-like [Cucumis sativus] Length = 284 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 342 RPPPKQRDKVDSIGRLPAPTKPIPFTAEEMD 250 RPPPKQ+DKVDSIGRLPAPTKPIPF+ E D Sbjct: 244 RPPPKQQDKVDSIGRLPAPTKPIPFSVEYED 274 >ref|XP_006598141.1| PREDICTED: 54S ribosomal protein L10, mitochondrial-like [Glycine max] Length = 103 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -3 Query: 342 RPPPKQRDKVDSIGRLPAPTKPIPFTAE 259 RPPPKQ+DKVDSIGRLPAPTKPIPF E Sbjct: 65 RPPPKQKDKVDSIGRLPAPTKPIPFLVE 92