BLASTX nr result
ID: Stemona21_contig00020854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00020854 (254 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003547888.1| PREDICTED: AT-rich interactive domain-contai... 56 4e-06 >ref|XP_003547888.1| PREDICTED: AT-rich interactive domain-containing protein 4-like [Glycine max] Length = 782 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/67 (43%), Positives = 40/67 (59%) Frame = +3 Query: 54 AGNSGVSWRKVDQNDQMKIKLVSGTRMPSTSGRQQLKAAAMRPIPHTRQRKMMPFGTVPA 233 AG GV ++ D+ K+V+G MP T RQ+LK +AMRPIPH R+ +M PF Sbjct: 476 AGQGGVCKLNEEEKDR---KIVNGISMPLTPARQRLKVSAMRPIPHIRRHRMTPFCGPSE 532 Query: 234 TDTYDAS 254 TD +D + Sbjct: 533 TDGFDGT 539