BLASTX nr result
ID: Stemona21_contig00019492
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00019492 (849 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW14679.1| hypothetical protein PHAVU_007G008100g [Phaseolus... 58 4e-07 ref|XP_002316324.2| hypothetical protein POPTR_0010s22050g [Popu... 54 1e-06 ref|XP_004307448.1| PREDICTED: uncharacterized protein LOC101291... 55 1e-06 ref|XP_006589759.1| PREDICTED: leukocyte receptor cluster member... 57 1e-06 ref|XP_006606555.1| PREDICTED: leukocyte receptor cluster member... 57 1e-06 ref|XP_006589755.1| PREDICTED: leukocyte receptor cluster member... 57 1e-06 ref|XP_006606556.1| PREDICTED: leukocyte receptor cluster member... 57 1e-06 ref|XP_006589756.1| PREDICTED: leukocyte receptor cluster member... 57 1e-06 gb|EMJ21474.1| hypothetical protein PRUPE_ppa000867mg [Prunus pe... 57 1e-06 ref|XP_006589757.1| PREDICTED: leukocyte receptor cluster member... 57 1e-06 ref|XP_006589758.1| PREDICTED: leukocyte receptor cluster member... 57 1e-06 ref|XP_006606557.1| PREDICTED: leukocyte receptor cluster member... 57 1e-06 ref|XP_006589760.1| PREDICTED: leukocyte receptor cluster member... 57 1e-06 ref|XP_006606558.1| PREDICTED: leukocyte receptor cluster member... 57 1e-06 ref|XP_006843660.1| hypothetical protein AMTR_s00007p00182220 [A... 57 2e-06 ref|XP_004495814.1| PREDICTED: leukocyte receptor cluster member... 55 3e-06 ref|XP_004495816.1| PREDICTED: leukocyte receptor cluster member... 55 3e-06 gb|EXB88503.1| hypothetical protein L484_017256 [Morus notabilis] 55 4e-06 ref|XP_006345910.1| PREDICTED: leukocyte receptor cluster member... 56 4e-06 ref|XP_006345911.1| PREDICTED: leukocyte receptor cluster member... 56 4e-06 >gb|ESW14679.1| hypothetical protein PHAVU_007G008100g [Phaseolus vulgaris] Length = 1019 Score = 58.2 bits (139), Expect(2) = 4e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 385 QC*SQLKSLYAEGITGSDIEFSAYNLLCVILH 480 QC SQLK+LYAEGI GSD+EF+AYNLLCVI+H Sbjct: 808 QCQSQLKTLYAEGIEGSDMEFAAYNLLCVIMH 839 Score = 23.1 bits (48), Expect(2) = 4e-07 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +2 Query: 458 ICCVLFYTNNKRDVLS 505 + CV+ ++NN RD++S Sbjct: 833 LLCVIMHSNNNRDLVS 848 >ref|XP_002316324.2| hypothetical protein POPTR_0010s22050g [Populus trichocarpa] gi|550330342|gb|EEF02495.2| hypothetical protein POPTR_0010s22050g [Populus trichocarpa] Length = 1048 Score = 54.3 bits (129), Expect(3) = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 385 QC*SQLKSLYAEGITGSDIEFSAYNLLCVILH 480 QC SQLK+LYAEGI G +EF+AYNLLCVILH Sbjct: 849 QCQSQLKTLYAEGIEGRHMEFAAYNLLCVILH 880 Score = 24.3 bits (51), Expect(3) = 1e-06 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 4/58 (6%) Frame = +2 Query: 458 ICCVLFYTNNKRDVLS----L*KGTQILMVFMHVLDSLAVMLS*YLIVLRRVQFHCDN 619 + CV+ ++NN RD++S L +GT+ H L A + S ++ R+ N Sbjct: 874 LLCVILHSNNNRDLVSSMSRLTEGTKKDKAVKHALAVRAAVTSGNYVMFFRLYKEAPN 931 Score = 20.4 bits (41), Expect(3) = 1e-06 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = +3 Query: 720 YLQNYRFLSYSCIWLSHRFLFELAVTCHVIG 812 Y++ R+ + SC+ S+R ++ V+G Sbjct: 940 YVEKMRYKAVSCMSWSYRPTIPVSYIAQVLG 970 >ref|XP_004307448.1| PREDICTED: uncharacterized protein LOC101291866 [Fragaria vesca subsp. vesca] Length = 1023 Score = 55.5 bits (132), Expect(2) = 1e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 385 QC*SQLKSLYAEGITGSDIEFSAYNLLCVILH 480 QC SQLKSLYA+GI G +EFSAYNLLCVILH Sbjct: 824 QCQSQLKSLYADGIEGCHMEFSAYNLLCVILH 855 Score = 24.3 bits (51), Expect(2) = 1e-06 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +2 Query: 458 ICCVLFYTNNKRDVLS 505 + CV+ ++NN RD+LS Sbjct: 849 LLCVILHSNNNRDLLS 864 >ref|XP_006589759.1| PREDICTED: leukocyte receptor cluster member 8 homolog isoform X5 [Glycine max] Length = 1010 Score = 56.6 bits (135), Expect(2) = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 385 QC*SQLKSLYAEGITGSDIEFSAYNLLCVILH 480 QC SQL++LYAEGI GSD+EF+AYNLLCVI+H Sbjct: 810 QCQSQLQTLYAEGIEGSDMEFAAYNLLCVIMH 841 Score = 23.1 bits (48), Expect(2) = 1e-06 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +2 Query: 458 ICCVLFYTNNKRDVLS 505 + CV+ ++NN RD++S Sbjct: 835 LLCVIMHSNNNRDLVS 850 >ref|XP_006606555.1| PREDICTED: leukocyte receptor cluster member 8 homolog isoform X1 [Glycine max] Length = 1006 Score = 56.6 bits (135), Expect(2) = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 385 QC*SQLKSLYAEGITGSDIEFSAYNLLCVILH 480 QC SQL++LYAEGI GSD+EF+AYNLLCVI+H Sbjct: 806 QCQSQLQTLYAEGIEGSDMEFAAYNLLCVIMH 837 Score = 23.1 bits (48), Expect(2) = 1e-06 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +2 Query: 458 ICCVLFYTNNKRDVLS 505 + CV+ ++NN RD++S Sbjct: 831 LLCVIMHSNNNRDLVS 846 >ref|XP_006589755.1| PREDICTED: leukocyte receptor cluster member 8 homolog isoform X1 [Glycine max] Length = 1006 Score = 56.6 bits (135), Expect(2) = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 385 QC*SQLKSLYAEGITGSDIEFSAYNLLCVILH 480 QC SQL++LYAEGI GSD+EF+AYNLLCVI+H Sbjct: 806 QCQSQLQTLYAEGIEGSDMEFAAYNLLCVIMH 837 Score = 23.1 bits (48), Expect(2) = 1e-06 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +2 Query: 458 ICCVLFYTNNKRDVLS 505 + CV+ ++NN RD++S Sbjct: 831 LLCVIMHSNNNRDLVS 846 >ref|XP_006606556.1| PREDICTED: leukocyte receptor cluster member 8 homolog isoform X2 [Glycine max] Length = 1005 Score = 56.6 bits (135), Expect(2) = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 385 QC*SQLKSLYAEGITGSDIEFSAYNLLCVILH 480 QC SQL++LYAEGI GSD+EF+AYNLLCVI+H Sbjct: 805 QCQSQLQTLYAEGIEGSDMEFAAYNLLCVIMH 836 Score = 23.1 bits (48), Expect(2) = 1e-06 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +2 Query: 458 ICCVLFYTNNKRDVLS 505 + CV+ ++NN RD++S Sbjct: 830 LLCVIMHSNNNRDLVS 845 >ref|XP_006589756.1| PREDICTED: leukocyte receptor cluster member 8 homolog isoform X2 [Glycine max] Length = 990 Score = 56.6 bits (135), Expect(2) = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 385 QC*SQLKSLYAEGITGSDIEFSAYNLLCVILH 480 QC SQL++LYAEGI GSD+EF+AYNLLCVI+H Sbjct: 790 QCQSQLQTLYAEGIEGSDMEFAAYNLLCVIMH 821 Score = 23.1 bits (48), Expect(2) = 1e-06 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +2 Query: 458 ICCVLFYTNNKRDVLS 505 + CV+ ++NN RD++S Sbjct: 815 LLCVIMHSNNNRDLVS 830 >gb|EMJ21474.1| hypothetical protein PRUPE_ppa000867mg [Prunus persica] Length = 976 Score = 56.6 bits (135), Expect(2) = 1e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +1 Query: 385 QC*SQLKSLYAEGITGSDIEFSAYNLLCVILH 480 QC SQLKSLYAEGI G +EFSAYNLLCVILH Sbjct: 777 QCQSQLKSLYAEGIEGCHMEFSAYNLLCVILH 808 Score = 23.1 bits (48), Expect(2) = 1e-06 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +2 Query: 458 ICCVLFYTNNKRDVLS 505 + CV+ ++NN RD++S Sbjct: 802 LLCVILHSNNNRDLVS 817 >ref|XP_006589757.1| PREDICTED: leukocyte receptor cluster member 8 homolog isoform X3 [Glycine max] Length = 964 Score = 56.6 bits (135), Expect(2) = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 385 QC*SQLKSLYAEGITGSDIEFSAYNLLCVILH 480 QC SQL++LYAEGI GSD+EF+AYNLLCVI+H Sbjct: 764 QCQSQLQTLYAEGIEGSDMEFAAYNLLCVIMH 795 Score = 23.1 bits (48), Expect(2) = 1e-06 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +2 Query: 458 ICCVLFYTNNKRDVLS 505 + CV+ ++NN RD++S Sbjct: 789 LLCVIMHSNNNRDLVS 804 >ref|XP_006589758.1| PREDICTED: leukocyte receptor cluster member 8 homolog isoform X4 [Glycine max] Length = 893 Score = 56.6 bits (135), Expect(2) = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 385 QC*SQLKSLYAEGITGSDIEFSAYNLLCVILH 480 QC SQL++LYAEGI GSD+EF+AYNLLCVI+H Sbjct: 693 QCQSQLQTLYAEGIEGSDMEFAAYNLLCVIMH 724 Score = 23.1 bits (48), Expect(2) = 1e-06 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +2 Query: 458 ICCVLFYTNNKRDVLS 505 + CV+ ++NN RD++S Sbjct: 718 LLCVIMHSNNNRDLVS 733 >ref|XP_006606557.1| PREDICTED: leukocyte receptor cluster member 8 homolog isoform X3 [Glycine max] Length = 889 Score = 56.6 bits (135), Expect(2) = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 385 QC*SQLKSLYAEGITGSDIEFSAYNLLCVILH 480 QC SQL++LYAEGI GSD+EF+AYNLLCVI+H Sbjct: 689 QCQSQLQTLYAEGIEGSDMEFAAYNLLCVIMH 720 Score = 23.1 bits (48), Expect(2) = 1e-06 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +2 Query: 458 ICCVLFYTNNKRDVLS 505 + CV+ ++NN RD++S Sbjct: 714 LLCVIMHSNNNRDLVS 729 >ref|XP_006589760.1| PREDICTED: leukocyte receptor cluster member 8 homolog isoform X6 [Glycine max] Length = 815 Score = 56.6 bits (135), Expect(2) = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 385 QC*SQLKSLYAEGITGSDIEFSAYNLLCVILH 480 QC SQL++LYAEGI GSD+EF+AYNLLCVI+H Sbjct: 615 QCQSQLQTLYAEGIEGSDMEFAAYNLLCVIMH 646 Score = 23.1 bits (48), Expect(2) = 1e-06 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +2 Query: 458 ICCVLFYTNNKRDVLS 505 + CV+ ++NN RD++S Sbjct: 640 LLCVIMHSNNNRDLVS 655 >ref|XP_006606558.1| PREDICTED: leukocyte receptor cluster member 8 homolog isoform X4 [Glycine max] Length = 812 Score = 56.6 bits (135), Expect(2) = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 385 QC*SQLKSLYAEGITGSDIEFSAYNLLCVILH 480 QC SQL++LYAEGI GSD+EF+AYNLLCVI+H Sbjct: 612 QCQSQLQTLYAEGIEGSDMEFAAYNLLCVIMH 643 Score = 23.1 bits (48), Expect(2) = 1e-06 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +2 Query: 458 ICCVLFYTNNKRDVLS 505 + CV+ ++NN RD++S Sbjct: 637 LLCVIMHSNNNRDLVS 652 >ref|XP_006843660.1| hypothetical protein AMTR_s00007p00182220 [Amborella trichopoda] gi|548846028|gb|ERN05335.1| hypothetical protein AMTR_s00007p00182220 [Amborella trichopoda] Length = 1061 Score = 56.6 bits (135), Expect(2) = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +1 Query: 385 QC*SQLKSLYAEGITGSDIEFSAYNLLCVILH 480 QC SQLKSLYAEGI G +EFSAYNLLCVILH Sbjct: 869 QCQSQLKSLYAEGIKGCHMEFSAYNLLCVILH 900 Score = 22.3 bits (46), Expect(2) = 2e-06 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +2 Query: 458 ICCVLFYTNNKRDVLS 505 + CV+ +++N RD+LS Sbjct: 894 LLCVILHSSNNRDLLS 909 >ref|XP_004495814.1| PREDICTED: leukocyte receptor cluster member 8 homolog isoform X1 [Cicer arietinum] gi|502117421|ref|XP_004495815.1| PREDICTED: leukocyte receptor cluster member 8 homolog isoform X2 [Cicer arietinum] Length = 1005 Score = 54.7 bits (130), Expect(2) = 3e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 385 QC*SQLKSLYAEGITGSDIEFSAYNLLCVILH 480 QC SQLK+LYAEGI GS +EF+AYNLLCVI+H Sbjct: 810 QCQSQLKTLYAEGIEGSYMEFAAYNLLCVIMH 841 Score = 23.5 bits (49), Expect(2) = 3e-06 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +2 Query: 458 ICCVLFYTNNKRDVLS 505 + CV+ ++NN RD+LS Sbjct: 835 LLCVIMHSNNYRDLLS 850 >ref|XP_004495816.1| PREDICTED: leukocyte receptor cluster member 8 homolog isoform X3 [Cicer arietinum] Length = 1004 Score = 54.7 bits (130), Expect(2) = 3e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 385 QC*SQLKSLYAEGITGSDIEFSAYNLLCVILH 480 QC SQLK+LYAEGI GS +EF+AYNLLCVI+H Sbjct: 809 QCQSQLKTLYAEGIEGSYMEFAAYNLLCVIMH 840 Score = 23.5 bits (49), Expect(2) = 3e-06 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +2 Query: 458 ICCVLFYTNNKRDVLS 505 + CV+ ++NN RD+LS Sbjct: 834 LLCVIMHSNNYRDLLS 849 >gb|EXB88503.1| hypothetical protein L484_017256 [Morus notabilis] Length = 2507 Score = 54.7 bits (130), Expect(2) = 4e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 385 QC*SQLKSLYAEGITGSDIEFSAYNLLCVILH 480 QC SQLKSLYAEGI G +EF+AYNLLCVI+H Sbjct: 2309 QCQSQLKSLYAEGIEGCHMEFAAYNLLCVIMH 2340 Score = 23.1 bits (48), Expect(2) = 4e-06 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +2 Query: 458 ICCVLFYTNNKRDVLS 505 + CV+ ++NN RD++S Sbjct: 2334 LLCVIMHSNNNRDLVS 2349 >ref|XP_006345910.1| PREDICTED: leukocyte receptor cluster member 8 homolog isoform X1 [Solanum tuberosum] Length = 999 Score = 56.2 bits (134), Expect(2) = 4e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 385 QC*SQLKSLYAEGITGSDIEFSAYNLLCVILH 480 QC SQLK+LYAEGI G D+EF+AYNLLCV+LH Sbjct: 801 QCQSQLKTLYAEGIKGCDMEFAAYNLLCVLLH 832 Score = 21.6 bits (44), Expect(2) = 4e-06 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +2 Query: 458 ICCVLFYTNNKRDVL 502 + CVL +++N RD+L Sbjct: 826 LLCVLLHSSNNRDLL 840 >ref|XP_006345911.1| PREDICTED: leukocyte receptor cluster member 8 homolog isoform X2 [Solanum tuberosum] Length = 997 Score = 56.2 bits (134), Expect(2) = 4e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 385 QC*SQLKSLYAEGITGSDIEFSAYNLLCVILH 480 QC SQLK+LYAEGI G D+EF+AYNLLCV+LH Sbjct: 799 QCQSQLKTLYAEGIKGCDMEFAAYNLLCVLLH 830 Score = 21.6 bits (44), Expect(2) = 4e-06 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +2 Query: 458 ICCVLFYTNNKRDVL 502 + CVL +++N RD+L Sbjct: 824 LLCVLLHSSNNRDLL 838