BLASTX nr result
ID: Stemona21_contig00019373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00019373 (483 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI35923.3| unnamed protein product [Vitis vinifera] 67 2e-09 gb|EOY27178.1| Hydroxyproline-rich glycoprotein family protein, ... 65 1e-08 ref|XP_002521366.1| conserved hypothetical protein [Ricinus comm... 64 3e-08 ref|XP_006390619.1| hypothetical protein EUTSA_v10019633mg [Eutr... 60 3e-07 ref|XP_006426604.1| hypothetical protein CICLE_v10025206mg [Citr... 60 4e-07 gb|EMJ16210.1| hypothetical protein PRUPE_ppa002494mg [Prunus pe... 59 5e-07 gb|AAM13859.1| unknown protein [Arabidopsis thaliana] 59 5e-07 gb|AAL50061.1| At1g72790/F28P22_2 [Arabidopsis thaliana] gi|1954... 59 5e-07 ref|NP_177422.1| hydroxyproline-rich glycoprotein family protein... 59 5e-07 ref|XP_006302100.1| hypothetical protein CARUB_v10020090mg [Caps... 57 3e-06 ref|XP_002887451.1| hypothetical protein ARALYDRAFT_476416 [Arab... 57 3e-06 gb|EOY30349.1| Hydroxyproline-rich glycoprotein family protein [... 57 3e-06 ref|XP_002329058.1| predicted protein [Populus trichocarpa] gi|5... 56 4e-06 >emb|CBI35923.3| unnamed protein product [Vitis vinifera] Length = 628 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/43 (76%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -1 Query: 297 EKEKDGGKEA-PLFCPSPDVNNKADMFIARFRAGLKLEKLNSI 172 + E +GG A PLFCPSPDVN KAD FIARFRAGLKLEK+NSI Sbjct: 538 KSETEGGDSAQPLFCPSPDVNTKADTFIARFRAGLKLEKINSI 580 >gb|EOY27178.1| Hydroxyproline-rich glycoprotein family protein, putative [Theobroma cacao] Length = 553 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 2/42 (4%) Frame = -1 Query: 291 EKDGGKEA--PLFCPSPDVNNKADMFIARFRAGLKLEKLNSI 172 E DGG+ PLFCPSPDV+ KAD FIARFRAGLKLEK+NS+ Sbjct: 497 EMDGGESTTGPLFCPSPDVDTKADNFIARFRAGLKLEKMNSV 538 >ref|XP_002521366.1| conserved hypothetical protein [Ricinus communis] gi|223539444|gb|EEF41034.1| conserved hypothetical protein [Ricinus communis] Length = 553 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 294 KEKDGGKEAPLFCPSPDVNNKADMFIARFRAGLKLEKLNSI 172 + K+G P FCPSPDVN KA+ FIARFRAGLKLEK+NS+ Sbjct: 495 RNKEGDSAMPSFCPSPDVNTKAENFIARFRAGLKLEKINSV 535 >ref|XP_006390619.1| hypothetical protein EUTSA_v10019633mg [Eutrema salsugineum] gi|557087053|gb|ESQ27905.1| hypothetical protein EUTSA_v10019633mg [Eutrema salsugineum] Length = 548 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 285 DGGKEAPLFCPSPDVNNKADMFIARFRAGLKLEKLNSI 172 DG + +FCPSPDV+ KAD FIARFRAGLKLEK+NS+ Sbjct: 493 DGKAASSMFCPSPDVDTKADDFIARFRAGLKLEKMNSV 530 >ref|XP_006426604.1| hypothetical protein CICLE_v10025206mg [Citrus clementina] gi|557528594|gb|ESR39844.1| hypothetical protein CICLE_v10025206mg [Citrus clementina] Length = 602 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/41 (70%), Positives = 32/41 (78%), Gaps = 3/41 (7%) Frame = -1 Query: 285 DGGKE---APLFCPSPDVNNKADMFIARFRAGLKLEKLNSI 172 DGG PL CPSPDVN KAD FIARFRAGL+LEK+NS+ Sbjct: 537 DGGDSPVVTPLSCPSPDVNTKADNFIARFRAGLRLEKMNSV 577 >gb|EMJ16210.1| hypothetical protein PRUPE_ppa002494mg [Prunus persica] Length = 666 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 288 KDGGKEAPLFCPSPDVNNKADMFIARFRAGLKLEKLNSI 172 + G +FCPSPDVN KAD FIARFRAGL+LEK+NS+ Sbjct: 610 ESGESPKAMFCPSPDVNTKADTFIARFRAGLRLEKMNSV 648 >gb|AAM13859.1| unknown protein [Arabidopsis thaliana] Length = 535 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/39 (74%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = -1 Query: 282 GGKEAP--LFCPSPDVNNKADMFIARFRAGLKLEKLNSI 172 G KEA +FCPSPDV+ KAD FIARFRAGLKLEK+NS+ Sbjct: 495 GSKEAAGSMFCPSPDVDTKADDFIARFRAGLKLEKMNSV 533 >gb|AAL50061.1| At1g72790/F28P22_2 [Arabidopsis thaliana] gi|19548027|gb|AAL87377.1| At1g72790/F28P22_2 [Arabidopsis thaliana] Length = 561 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/39 (74%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = -1 Query: 282 GGKEAP--LFCPSPDVNNKADMFIARFRAGLKLEKLNSI 172 G KEA +FCPSPDV+ KAD FIARFRAGLKLEK+NS+ Sbjct: 495 GSKEAAGSMFCPSPDVDTKADDFIARFRAGLKLEKMNSV 533 >ref|NP_177422.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis thaliana] gi|12323765|gb|AAG51845.1|AC010926_8 unknown protein; 15669-13984 [Arabidopsis thaliana] gi|24030251|gb|AAN41301.1| unknown protein [Arabidopsis thaliana] gi|332197252|gb|AEE35373.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis thaliana] Length = 561 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/39 (74%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = -1 Query: 282 GGKEAP--LFCPSPDVNNKADMFIARFRAGLKLEKLNSI 172 G KEA +FCPSPDV+ KAD FIARFRAGLKLEK+NS+ Sbjct: 495 GSKEAAGSMFCPSPDVDTKADDFIARFRAGLKLEKMNSV 533 >ref|XP_006302100.1| hypothetical protein CARUB_v10020090mg [Capsella rubella] gi|482570810|gb|EOA34998.1| hypothetical protein CARUB_v10020090mg [Capsella rubella] Length = 550 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 264 LFCPSPDVNNKADMFIARFRAGLKLEKLNSI 172 +FCPSPDV+ KAD FIARFRAGLKLEK+NS+ Sbjct: 502 MFCPSPDVDTKADDFIARFRAGLKLEKMNSV 532 >ref|XP_002887451.1| hypothetical protein ARALYDRAFT_476416 [Arabidopsis lyrata subsp. lyrata] gi|297333292|gb|EFH63710.1| hypothetical protein ARALYDRAFT_476416 [Arabidopsis lyrata subsp. lyrata] Length = 552 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 264 LFCPSPDVNNKADMFIARFRAGLKLEKLNSI 172 +FCPSPDV+ KAD FIARFRAGLKLEK+NS+ Sbjct: 504 MFCPSPDVDTKADDFIARFRAGLKLEKMNSV 534 >gb|EOY30349.1| Hydroxyproline-rich glycoprotein family protein [Theobroma cacao] Length = 610 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 267 PLFCPSPDVNNKADMFIARFRAGLKLEKLNSI 172 P+FCPSPDVN KA+ FIARFR GLKLEK+NS+ Sbjct: 573 PVFCPSPDVNAKAETFIARFRDGLKLEKINSM 604 >ref|XP_002329058.1| predicted protein [Populus trichocarpa] gi|566150019|ref|XP_006369280.1| hydroxyproline-rich glycoprotein [Populus trichocarpa] gi|550347738|gb|ERP65849.1| hydroxyproline-rich glycoprotein [Populus trichocarpa] Length = 560 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 264 LFCPSPDVNNKADMFIARFRAGLKLEKLNS 175 LFCPSPDVN KAD FIARFRAGL LEK+NS Sbjct: 511 LFCPSPDVNTKADNFIARFRAGLTLEKVNS 540